(data stored in ACNUC7421 zone)

EMBL: CP000386.PE224

CP000386.PE224       Location/Qualifiers
FT   CDS_pept        231513..232361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03205"
FT                   /db_xref="GOA:Q1AZH3"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH3"
FT                   /protein_id="ABG03205.1"
FT                   /translation="MREVFTMWRHTQMVVLVALTAAIYAATLIPTQFLPIIPGFTNVRP
FT                   ANVFPFVFGLLFGPAGAWGAAVGNLINDFFGTLGLGSIGGFVGNFFLGFLPYKMWSSFF
FT                   RRGEDIEPNLASRKKLVVFLAIVVLASAVCAVWIAWWNDLLGFVPFAALAAVITVNNAL
FT                   AGLVLGPIFMVLLYPRIRRWGLLWTEIMEPEEVSASRLRLLGNVLMWVGGLGGLIVGFA
FT                   IGLGLYEQGFAAAGFAAGGAGGLGIGLGLLPFLALIVVASFLLGGREQVEAARRAPRRV
FT                   R"
     atgagagagg tgttcaccat gtggcggcac acgcagatgg tcgtgctggt ggcgctgacg        60
     gcggccatct atgcggccac cctcatcccc acccagtttc tccccatcat ccccgggttc       120
     accaacgtcc ggccggcgaa cgtcttcccg ttcgtcttcg gcctgctgtt cgggcccgca       180
     ggggcgtggg gcgcggcggt gggcaacctg atcaacgact tcttcggaac gctggggctg       240
     gggagcatcg gcgggttcgt cgggaacttc ttcctgggtt ttctgcctta caagatgtgg       300
     agctcgttct tccgccgcgg ggaggacatc gagccgaacc tggcctcccg caagaagctc       360
     gtggtctttc tggccatcgt ggtgctggcc tcggcggtgt gcgcggtctg gatagcctgg       420
     tggaacgacc tgctcggctt cgtccccttc gcggcgctcg cggcggtcat cacggtcaac       480
     aacgccctcg ccggcctggt cctcggcccc atcttcatgg tgctcctcta cccccggata       540
     aggcgctggg gcctgctgtg gacggagatc atggagcccg aggaggtctc cgcttcccgg       600
     ctccggctgc tgggcaacgt gctgatgtgg gtcggcgggc tgggcggcct gatcgtgggg       660
     ttcgcgatcg ggctgggcct ctacgagcag ggcttcgccg ccgccgggtt cgccgccggg       720
     ggcgcgggcg ggctgggcat agggctcggc ctgctcccgt ttctggcctt gatcgtggtg       780
     gccagcttcc tgctgggcgg gcgcgagcag gtcgaggcgg cccggcgcgc gccgcggcgg       840
     gtccggtag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page