(data stored in ACNUC7421 zone)

EMBL: CP000386.PE226

CP000386.PE226       Location/Qualifiers
FT   CDS_pept        233750..234748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0229"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase HI0933-like
FT                   protein; KEGG: mpa:MAP4339 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03207"
FT                   /db_xref="GOA:Q1AZH1"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH1"
FT                   /protein_id="ABG03207.1"
FT                   /translation="MSEQYDVVVVGSGPAGYTAALYAARANLRTLVFQGFEAGGQLMLT
FT                   TDVENYPGYPEGVTGPEMMEDFERQAARFGAEMRPDNVDRVDFSGRPFRLWAEGQEEPV
FT                   LARAVIVATGAKARWLGLPGEQRLMGRGVSGCATCDGFFFKDKRVAVVGGGDTAMEEAL
FT                   FLSRYASEVVIIHRRDEFRASKIMLGRARKNPKISFITDTVVTDVLGEDAVEGLSLRNV
FT                   KTGEESTLEVEGFFVAIGHDPATEIFRGQLEMDEGGYLLQKEHTMTSVPGVFAAGDVAD
FT                   RRYRQAVTAAGDGCRAAIDAERWLEEQGEAQEAEDPGVWTAGKDRSPAGSG"
     atgtccgagc agtacgacgt ggtggtggta ggctccgggc ccgcgggcta caccgcggcg        60
     ctctacgccg cccgggccaa cctgaggacg ctggtcttcc aggggttcga ggcggggggg       120
     cagctcatgc tcaccaccga cgtggagaac tacccgggct accccgaggg ggtgaccggt       180
     cccgagatga tggaggactt cgagcggcag gccgcccgct tcggggccga gatgcgcccg       240
     gacaacgtgg acagggtgga cttctccggg cggcccttca ggctgtgggc cgaggggcag       300
     gaggagccgg tgctcgcccg ggcggtcatc gtggccacgg gggcgaaggc ccggtggctc       360
     gggctgcccg gggagcagcg cctcatgggc cgcggggtga gcggctgcgc cacctgcgac       420
     ggcttcttct tcaaggacaa gcgggtcgcc gtggtcggcg gcggggacac cgcgatggag       480
     gaggcgctct tcctcagccg ctacgcctcg gaggtcgtga tcatccaccg gcgcgacgag       540
     ttcagggcct ccaagatcat gctgggccgc gcgaggaaga acccgaagat ctcgttcatc       600
     accgacacgg tggtgaccga cgtgctgggc gaggacgcgg tggagggcct gagcctgagg       660
     aacgtgaaga ccggcgagga gagcacgctg gaggtggagg gcttcttcgt cgccatcggc       720
     cacgacccgg ccacggagat cttccgcggc cagctggaga tggacgaggg cggctacctc       780
     ctgcagaagg agcacacgat gaccagcgtg cccggggtgt tcgccgccgg ggacgtcgcc       840
     gacaggcgct atcggcaggc ggtcaccgcg gcgggggacg gctgccgcgc ggcgatagac       900
     gctgagcgct ggctggagga gcagggcgag gcccaggagg ccgaggaccc cggcgtgtgg       960
     accgccggca aggaccggag ccccgcgggg agcggctag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page