(data stored in ACNUC7421 zone)

EMBL: CP000386.PE227

CP000386.PE227       Location/Qualifiers
FT   CDS_pept        complement(235008..236717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0230"
FT                   /product="PHP-like protein"
FT                   /note="PFAM: PHP-like; SMART: DNA polymerase X
FT                   Phosphoesterase PHP-like Helix-hairpin-helix DNA-binding,
FT                   class 1; KEGG: mca:MCA1213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03208"
FT                   /db_xref="GOA:Q1AZH0"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH0"
FT                   /protein_id="ABG03208.1"
FT                   /translation="MQNADIARALETIATLLEIRGEEHYRVLAYQRAAESVAASGRPVA
FT                   ELDDPRSLPHVGGTTARVIKDLAQNRTPEILAELSAEIPAGLVELTRLPGVGPRTAGRL
FT                   WRELGVTSVEEVAALGEGSIAALRGFGKKSEESILRAARAHGARERRMLLDEATAFGER
FT                   LLEFVRSHPAAERAEIAGSLRRQKETVGDLDIVAASDDPKALTDAFAAAPFVEEVASHG
FT                   PTGASVVCAGGVEADLRVVSPEAFGSLLHHFTGSQAHNVALRERAVKRGLRISEYGLAG
FT                   AGSDRYEPLRTEEELYARLGLPYIPPELREDTGEIEAAERGELPDPVGVEDIRGDLHVH
FT                   TSYSDGKGTIESMAEAAIALGYEYLVFCDHSQSLRVANGLSPARLAEKMEAVRRADERY
FT                   PEIHLLCGAEVDILRDGSLDYEDAVLAELDFVVASVHTAFRMDEGSMTDRIVRAMHNPH
FT                   VRTIGHPTGRLLNRRDPYAVDVSRLIREAAATNTALELNAYPDRLDLSVPHAREAARAG
FT                   VRLTIDTDAHDERALSFMRFGVSQARRAWVEKESVINCLPWPEFERYLRRGK"
     ttgcagaacg cggacatagc gcgcgccctc gagacgatag ccaccctgct ggagatccgg        60
     ggcgaggagc actacagggt gctcgcctac cagcgggccg ccgagtcggt cgccgcctcc       120
     ggcaggccgg tggccgagct ggacgatccc cggagcctcc cccacgtcgg cggcaccacc       180
     gcccgcgtga taaaagacct cgcgcagaac agaacgccgg agatcctggc cgagctctcc       240
     gccgagatcc cggcggggct ggtggagctc acccgcctgc cgggcgtggg gccgcgcacc       300
     gccggccggc tctggcggga gctgggggtg acgagcgtgg aggaggtggc cgccctcggg       360
     gaggggagca tcgccgcgct caggggcttc gggaagaaga gcgaggagag catcctcagg       420
     gccgcgcgcg cccacggcgc gcgggagcgg cggatgctgc tggacgaggc caccgccttc       480
     ggcgagcggc tgctggagtt cgtccgctcc cacccggcgg cggagcgggc cgagatcgcc       540
     ggctccctgc ggcgccagaa ggagaccgtg ggggacctgg acatcgtcgc cgcgagcgac       600
     gacccgaagg ccctcaccga cgccttcgcc gccgccccct tcgtggagga ggtcgcctcc       660
     cacggcccga ccggcgcctc cgtcgtctgc gccggcggcg tggaggcgga cctgcgggtg       720
     gtctcccccg aggcgttcgg ctccctgctg caccacttca ccgggagcca ggcgcacaac       780
     gtggcgctgc gcgagcgggc ggtgaagagg gggctcagga tctccgagta cgggctggcc       840
     ggcgccggct ccgaccgcta cgagcccctg cggacggagg aggagctcta cgcgcggctc       900
     gggctgccgt acatcccgcc ggagctgcgg gaggacaccg gcgagataga ggccgccgag       960
     aggggggagc tcccggaccc ggtcggggtc gaagacatcc ggggcgacct gcacgtccac      1020
     accagctact cggacggcaa gggcaccata gagagcatgg ccgaggccgc catcgccctg      1080
     ggctacgagt acctcgtctt ctgcgaccac tcgcagagcc tgcgcgtggc gaacggcctc      1140
     tcccccgccc ggctggcgga gaagatggag gccgtccgcc gcgccgacga gaggtacccc      1200
     gagatccacc tgctgtgcgg ggcggaggtg gacatcctgc gcgacggctc gctggactac      1260
     gaggacgccg tgctcgccga gctggacttc gtcgtcgcct cggtgcacac ggccttccgc      1320
     atggacgagg gctccatgac cgaccggatc gtacgggcca tgcacaaccc ccacgtccgg      1380
     acgatcggcc accccaccgg ccgcctcctg aaccgccgcg acccctacgc ggtggacgtc      1440
     tcccgcctca tccgcgaggc cgccgccacg aacaccgccc tggagctgaa cgcctacccg      1500
     gaccgcctcg acctctccgt cccccacgcc cgcgaggcgg cgcgcgccgg ggtgcggctg      1560
     accatcgaca ccgacgccca tgacgagcgg gcgctctcgt tcatgcggtt cggcgtgtcc      1620
     caggcccgcc gcgcctgggt ggagaaggag agcgtcatca actgcctgcc ctggccggag      1680
     ttcgagcggt acctgagaag gggcaagtag                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page