(data stored in ACNUC7421 zone)

EMBL: CP000386.PE23

CP000386.PE23        Location/Qualifiers
FT   CDS_pept        complement(25183..26472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0023"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: mbo:Mb0017c probable
FT                   cell division protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03004"
FT                   /db_xref="GOA:Q1B024"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B024"
FT                   /protein_id="ABG03004.1"
FT                   /translation="MTQRATMPMILALLVSTLGFATLIFVQEATSPPLVYGAYYAGTLF
FT                   ALYLAVRLLLPHSDVLLLPIVTLLTGLGLVMIFRLTYDVEGVENLAITQAVWILIGSAA
FT                   LLFIVLFFRNYERLFDYKYLFALAAVVLICLTFTPLGYEVNGARLWVRIGPVNFQPSEF
FT                   ARIALIIFYAGYLAEKRDLLAATSRSVLGVQIPSPKYFGPVALVWAVSLGLLVFERDLG
FT                   SSLLFFAVPLLMLYVATGRLAYVIIGGLMFSGGAFATYLLFDHVRVRVQTWLDPWQNPD
FT                   AEGFQILQSIFNIADGGITGTGLGAGFAQTIPEVHTDFIFSAIASELGLLGATAVLLAF
FT                   LVFVYRGIKISLLAGDEASKLLAYGLTAMFALQTLIIVGGVTRLIPLTGITLPFVSYGG
FT                   SSVVGNFILTGLLLVVSEKAGRRELGKEAR"
     gtgacccagc gcgccaccat gcccatgatc ctggccctgc tggtgagcac cctggggttc        60
     gccaccctca tcttcgtgca ggaggccacc agcccgccgc tcgtctacgg ggcctactac       120
     gcggggaccc tgttcgcgct ctacctggcg gtgcgtctgc tgctccccca ctccgacgtg       180
     ctgctgctcc ccatcgtcac cctgctgacc ggcctcgggc tggtcatgat cttccggctc       240
     acctacgacg tggagggggt agagaacctc gccataaccc aggcggtctg gatcctcatc       300
     ggcagcgcgg cgctgctgtt catagtcctc ttcttccgca actacgagcg cctcttcgat       360
     tacaagtacc tcttcgcgct ggcggcggtc gtcctcatct gcctcacctt cacacccctg       420
     ggctacgagg tcaacggggc ccggctgtgg gtgcggatag ggccggtcaa cttccagccc       480
     tcggagttcg cccgcatagc gctcatcatc ttctacgccg ggtacctggc cgagaagcgg       540
     gacctcctgg cggccaccag ccggagcgtg ctgggcgtgc agatcccctc ccccaagtac       600
     ttcggtccgg tcgccctggt gtgggccgtc tcgctcgggc ttctggtctt cgagcgggac       660
     ctgggcagca gcctcctctt cttcgcggtg cccctcctca tgctctacgt ggccaccggc       720
     aggctcgcct acgtcattat cggggggctc atgttctccg gcggggcctt cgccacctac       780
     ctgctcttcg accacgtgcg ggtcagggtg cagacctggc tcgacccctg gcagaacccc       840
     gacgccgagg gcttccagat cctgcagagc atcttcaaca tcgccgacgg cgggatcacc       900
     ggcacgggcc tgggggccgg cttcgcccag accatccccg aggtccacac cgacttcatc       960
     ttcagcgcca tcgccagcga gctggggcta ctcggggcca cggcggtgct cctcgccttt      1020
     ctggtcttcg tctaccgggg gatcaagatc tccctcctcg ccggggacga ggcctcgaag      1080
     ctgctcgctt acgggctgac cgccatgttc gccctgcaga ccctcatcat cgtcgggggg      1140
     gtgacgcgcc tgatcccgct caccggcatc accctgccct tcgtctccta cggcggctcc      1200
     tcggtggtgg gcaacttcat cctgacgggg ctcctgctgg tcgtctccga gaaggccggc      1260
     cggcgggagc tggggaagga ggcgcggtga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page