(data stored in ACNUC7421 zone)

EMBL: CP000386.PE233

CP000386.PE233       Location/Qualifiers
FT   CDS_pept        complement(242203..243711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0236"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: sma:SAV5722
FT                   putative acetyl CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03214"
FT                   /db_xref="GOA:Q1AZG4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG4"
FT                   /protein_id="ABG03214.1"
FT                   /translation="MRRGERFYRFRAKKRGGGRALPGGGRGVASPAAREAIGAVATGFR
FT                   EFGEELVSGDPLGWPGYPEKLARVRERTGEGESVVVGEAQVGKTPVVVVAFDFRFLGGS
FT                   VGEAAGRRIVEAFERARESRRAVVSLVATGGSRMQEGMRSLVQLQRIADACVRAREEGI
FT                   PHISVLRGPVTGGIWASLGSSADYIIGVRGAEVAFAGSRVRGEEATEGEAFTAAGKLRS
FT                   GFVDAEAEPGEVPGLLRSAVELLRPAGGEPPAPPEVPRALGFARPPRDPWVAVMRARSP
FT                   RRPRAEAYLEDYFERRVEISGDRAGGVDAGMLCGFGRRRGRTIAYAAQNGTANTAAGFR
FT                   TARRLLELADRLQLPVLTLIDTPGAGNTAKDEREGVGTAIAELFCTVAGLKVPITSLVI
FT                   GEGGSGGALALAAPDNLWVTPDAYFAVISPEGAAAIVEKDRSRARQVAGRMKLMPQDLV
FT                   ELGVVRGIARPKRRPARAIRTSYDAVRRWVVRGHSSGKEHVTKS"
     gtgcgacgag gggagaggtt ctaccggttt cgcgctaaga agaggggcgg ggggcgtgcc        60
     ctgccgggag gggggcgcgg ggtggcgtcg ccggcggccc gggaggcgat cggggccgtg       120
     gcgacggggt tcagggagtt cggggaggag ctggtctcag gagatccgtt ggggtggccc       180
     ggctatccgg agaagcttgc gcgggttcgc gagcggaccg gggaggggga gtcggtggtc       240
     gtgggggagg cgcaggtggg caagacgccc gtcgtggtcg tcgccttcga cttccgcttt       300
     ctggggggct cggtgggcga ggccgcgggg cgcaggatcg tcgaggcctt cgagcgggcg       360
     cgggagagcc gcagggcggt cgtctcgctc gtggccacgg gcgggagcag gatgcaggag       420
     gggatgcgct cgctcgtcca gctgcagagg atcgccgacg cgtgcgtccg ggcgcgcgag       480
     gaggggatcc cccacatcag cgtgctgcgc ggccccgtca ccggcgggat atgggcgtcg       540
     ctgggttcct ccgccgacta catcataggg gtgcgggggg ccgaggtcgc cttcgccggc       600
     tcgcgggtcc gcggggagga ggcgaccgaa ggcgaggcct tcaccgcggc gggcaagctc       660
     cgctccggct tcgtggacgc cgaggcggag cccggggagg tgcccggcct cctgagatcg       720
     gcggtggagc tgctccgtcc ggcgggcggg gagccgccgg cccctcccga ggtgccgcgg       780
     gcgctcgggt tcgcccggcc ccccagggac ccgtgggtcg cggtgatgcg ggcgcgcagc       840
     ccccggcggc cgcgggcgga ggcgtacctc gaggactact tcgagaggcg ggtggagatc       900
     tccggcgacc gggccggggg cgtggacgcg ggcatgctct gcggcttcgg gcggcggcgc       960
     gggaggacca tagcctacgc cgcgcagaac ggcacggcca acaccgccgc cggcttccgc      1020
     accgcccggc gcctcctgga gctcgccgac aggctccagc tgccggtgct caccctcatc      1080
     gacaccccgg gggccggcaa cacagccaag gacgagcgcg agggtgtcgg gaccgccatc      1140
     gccgagctct tctgcaccgt ggccggcctc aaggtcccca taacctcgct cgtcatcggg      1200
     gaggggggat cgggcggggc gctcgcgctc gccgccccgg acaacctctg ggtcacgccc      1260
     gacgcctact tcgccgtcat ctccccggag ggagcggccg ccatagtgga gaaagaccgc      1320
     tccagggccc gccaggtcgc ggggcgcatg aagctcatgc cgcaggatct ggtcgagctg      1380
     ggcgtggtcc gggggatcgc acggcccaag cgccgcccgg cgcgggccat caggacatcg      1440
     tacgacgccg tacgccggtg ggtagtgagg ggtcactctt cgggaaagga gcacgtaacg      1500
     aaaagctaa                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page