(data stored in ACNUC7421 zone)

EMBL: CP000386.PE237

CP000386.PE237       Location/Qualifiers
FT   CDS_pept        247896..248894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0241"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: Uncharacterized protein UPF0065; KEGG: bja:blr4371
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03218"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG0"
FT                   /protein_id="ABG03218.1"
FT                   /translation="MGGGMTRREFLVAGGGALAGALVFGGCAGGGGSGGGGSGWEPSRN
FT                   VVMIVPFEPGGGSDILGRAMAAGLEEVREEVNVSVENRAGGSGAVGYSYLLEQRGDPHF
FT                   LLASETAGVALPITTETPFRWTDFTPVAQIAEDATLLIVRRGSDYRSLQDVVDAAREGR
FT                   VTVGVAGATGLDTIVTSLVEEQTGVEFERVVFESGGEIVAALLGGDIDIASLNPSEVIG
FT                   QLEAGKMRALAVFADERYERGMLAEIPTAREEGVDVSFTQYRGAFAAGGITPEQRQYWE
FT                   RAFVDWTKRQSYRKYIRDNYLISVVRTGEEFEGYLRDYEKTLEKVLGGQSR"
     atgggtgggg gcatgacgcg gcgggagttc ctggtggccg ggggaggggc gcttgcgggg        60
     gcgctcgttt tcggcggttg cgcgggcggc gggggttctg ggggcggcgg gtcgggctgg       120
     gagccgagcc gcaacgtcgt catgatcgta ccgttcgagc ccgggggcgg gagcgacatc       180
     ctggggcggg cgatggccgc ggggctggag gaggtccgcg aggaggtcaa cgtcagcgtg       240
     gagaaccggg cggggggctc tggggcggtg ggctattcgt acctgctgga gcagcggggg       300
     gacccgcact tcctgctggc ctccgagacg gcgggcgtgg cgctgcccat cacgaccgag       360
     acgcccttcc gctggacgga cttcacgccc gtagcccaga tcgccgagga cgccacgctc       420
     ctcatcgtcc ggcggggctc ggattaccgc tcgctgcagg acgtcgtaga cgcggcgcgg       480
     gaggggcggg tcaccgtggg ggtggcgggg gcgaccgggc tcgacaccat cgtcacctcg       540
     ctcgtggagg agcagaccgg ggtggagttc gagcgggtcg tcttcgagtc ggggggcgag       600
     atcgtcgcgg cgttgctcgg gggcgacata gacatcgcct cgctcaaccc cagcgaggtc       660
     atcgggcagc tggaggcggg caagatgcgg gcgctcgccg tcttcgccga cgagcgctac       720
     gagcggggga tgctcgccga gatcccgacg gccagggagg agggggtgga cgtctccttc       780
     acccagtacc ggggggcctt cgcggccggg gggatcacgc ccgagcagcg gcaatactgg       840
     gagcgggcct tcgtggactg gacgaagcgc cagagctaca ggaagtacat ccgggacaac       900
     tacctcatct cggtggtccg cacgggggag gagttcgagg gctacctgcg ggactacgag       960
     aagacgctcg agaaggtgct cggggggcag tcccggtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page