(data stored in ACNUC7421 zone)

EMBL: CP000386.PE242

CP000386.PE242       Location/Qualifiers
FT   CDS_pept        252866..253414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0246"
FT                   /product="carbonic anhydrase/acetyltransferase isoleucine
FT                   patch superfamily-like protein"
FT                   /note="KEGG: tfu:Tfu_0193 similar to carbonic
FT                   anhydrase/acetyltransferase isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03223"
FT                   /db_xref="GOA:Q1AZF5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF5"
FT                   /protein_id="ABG03223.1"
FT                   /translation="MEPFFGEVGGLRPRVAPDAFVAPGAVLVGGVRVGARSSVWYGSVL
FT                   RADDEEVVVGEGCNIQDLCLMHADPGYPAVLEDGVSVGHRAIVHGATVREGSLVGMGAV
FT                   LLNGVVLGPGSVVAAGAVVTPGTEIPSGSLVAGVPARVVRPAREADREMIRHTARSYLR
FT                   KSGLHREARPLRREEVEAG"
     atggagccct ttttcgggga ggtgggcggg ctgcggccgc gcgtcgcccc ggacgccttc        60
     gtcgcgccgg gggcggtcct ggtcggcggg gtgcgcgtcg gggcccgctc cagcgtgtgg       120
     tacgggagcg tgctgcgggc cgacgacgag gaggtcgtcg tgggggaggg gtgcaacatc       180
     caggatctct gcctgatgca cgccgacccc ggctacccgg cggtgctgga ggacggggtc       240
     tcggtgggcc acagggccat cgtgcacggg gccacggtgc gggagggctc gctggtgggg       300
     atgggcgccg tcctcctcaa cggggtggtg ctcggcccgg gctcggtcgt cgccgccggg       360
     gcggtggtga ccccgggcac cgagataccc tccggctcgc tggtggccgg cgtcccggcg       420
     cgggtggtgc ggccggcgcg cgaggcggac cgggagatga tccgccacac cgcgcggagc       480
     tacctgcgga agtccgggct gcaccgggag gcgcgccccc tgcggcggga ggaggtggag       540
     gccggatga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page