(data stored in ACNUC7421 zone)

EMBL: CP000386.PE245

CP000386.PE245       Location/Qualifiers
FT   CDS_pept        255411..256214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0249"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   cef:CE0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03226"
FT                   /db_xref="GOA:Q1AZF2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF2"
FT                   /protein_id="ABG03226.1"
FT                   /translation="MPPVSFVELFGLDLSHLVLYAAIGTVGGLLSGLIGVGGGVFFVPA
FT                   LVYGAGWNIKEAVAASLVIIVFSALSGTVRNAGSRDPVDWRVAGLLSLAVAPASLIGVF
FT                   VSRFSPDEVVKVAFALIILALAAPTARGGSGPLEGRRKIPRWLVFAAGVLIGALSGLVG
FT                   VGGGVMMVPLMVLGLGLSAKRAVSTSLAVVMFTGLVGASGYIATGFRDPHELLSLPPLI
FT                   AGSMVGAWLGVKVRDPLPDGAIRVGFAGFMVLVSLRTLGGVAGVV"
     ttgccgccgg tgtctttcgt ggagcttttt ggtctggacc tctcgcatct cgtgctctac        60
     gccgcgatag ggaccgtggg ggggttgctc tccgggctca tcggggtggg cggcggcgtg       120
     ttcttcgtcc cggcgctggt gtacggggcg gggtggaaca taaaggaggc ggtggcggcg       180
     agcctggtga tcatcgtctt cagcgccctc tccggcaccg tgcgcaacgc cggcagccgg       240
     gacccggtcg actggcgggt ggcggggctc ctctcgctgg cggtggcgcc cgcctcgctc       300
     atcggggtgt tcgtgagccg cttctcgccc gacgaggtgg tcaaggtggc cttcgccctc       360
     atcatcctgg cgctggcggc gcccaccgcc cgcggcggga gcggcccgct ggaggggagg       420
     aggaagatcc cccgctggct ggtcttcgcc gccggggtcc tcatcggggc gctctccggg       480
     ctcgtcgggg tgggcggcgg ggtaatgatg gtgccgctga tggtgctggg gctcgggctc       540
     tcggccaagc gggccgtctc cacgagcctc gcggtggtga tgttcaccgg cttggtgggg       600
     gcctccgggt acatcgccac gggcttcagg gacccgcacg agctgctcag cctgccgccc       660
     ctgatcgccg gttcgatggt cggggcgtgg ctcggggtga aggtgcgcga cccgctgccg       720
     gacggggcga tccgggtggg cttcgccggc tttatggtgc tggtctcttt gcgcacgctg       780
     ggcggggttg cgggtgtcgt ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page