(data stored in ACNUC7421 zone)

EMBL: CP000386.PE252

CP000386.PE252       Location/Qualifiers
FT   CDS_pept        complement(263398..263667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0256"
FT                   /product="CRISPR-associated protein, Cas2 family"
FT                   /note="PFAM: protein of unknown function DUF196; KEGG:
FT                   tma:TM1796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03233"
FT                   /db_xref="GOA:Q1AZE5"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE5"
FT                   /protein_id="ABG03233.1"
FT                   /translation="MYVIMVYDVNVKRVVKVLKVGRKYLEHVQNSVLEGELSPAQYKKL
FT                   KHEVEKTIDPEEDTVRFYLLRTTRYLTTEELGLPSRNEPDSSFL"
     ttgtacgtga tcatggtcta cgacgtgaac gtcaagcggg tggtcaaggt gctcaaggtc        60
     ggccggaagt acctcgagca cgtccagaac tccgtgcttg agggggagct gagccccgcc       120
     cagtacaaga agctcaagca cgaggtggag aagacgatag accccgagga ggataccgta       180
     cgcttctacc tacttcgcac cacgagatac ctcaccaccg aggagctcgg cctgccctca       240
     cgcaatgagc cggatagcag cttcctgtag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page