(data stored in ACNUC7421 zone)

EMBL: CP000386.PE253

CP000386.PE253       Location/Qualifiers
FT   CDS_pept        complement(263671..264666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0257"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: chy:CHY_2152
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03234"
FT                   /db_xref="GOA:Q1AZE4"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE4"
FT                   /protein_id="ABG03234.1"
FT                   /translation="MKRPVYIFNAGELQRQQNTLRFTLADGKRRFVPVETTGEIHVFGE
FT                   VSVNTKLLVFLAQNAIPLHVYNYYGYWSGSYMPREQYVSGYLTLKQAEHYLDHEMRLVL
FT                   ARAFVRGAMENMERVLGYYARRGVELDGQLAEIAGKKESLPLALTTEELMAVEGGCRDL
FT                   YYGCWDGIVKSEEFRFEKRTRRPPANRINALVSFGNSLLYVTVLSEIHRTHLDPRIGFL
FT                   HTTNQRRYTLNLDVAEVFKPIIVDRVIFSLLNRGAIQAKHFHKGTEGVFLNESGRKTFI
FT                   EAYETRLKETIKHPKLGRPVSYRRLIRMELYKLEKHLMGDEPYEPFVSRW"
     atgaagaggc ccgtctacat cttcaacgcc ggcgagctgc agaggcaaca aaacacgctg        60
     cgcttcacgc tcgccgacgg caagcgccgc ttcgtcccgg tggagaccac gggcgagatc       120
     cacgtcttcg gcgaggtctc ggtcaacacg aagctcctcg tctttctggc ccagaacgcc       180
     atcccgctcc acgtctacaa ctactatggc tactggtcgg gctcgtacat gccgcgcgag       240
     cagtacgtct cgggctacct caccctgaag caggccgagc actacctcga ccacgagatg       300
     cgtctcgttc tcgcccgcgc cttcgtgcgc ggggcgatgg agaacatgga gcgggtgctc       360
     ggctactacg cccggcgcgg cgtggagctg gatgggcaac tggcggagat cgccggcaag       420
     aaggagagcc tgccgctcgc cctgaccacg gaggagctta tggccgtcga gggcgggtgc       480
     cgggacctct actacggctg ctgggacggg atcgtaaaga gcgaggagtt ccgcttcgag       540
     aagcgcaccc gcaggccacc ggcaaacagg atcaacgcgc tcgtctcctt cggcaacagc       600
     ctcctctacg tgaccgtcct ctcggagatc caccgcaccc acctcgaccc ccgcatcggt       660
     tttctgcaca ccaccaacca gcgccgctac accctcaacc tggacgtggc cgaggtcttc       720
     aagccgatca tcgtggaccg cgtgatcttc tcgctcctga accggggcgc gatccaggcg       780
     aaacacttcc acaagggcac cgagggcgtc ttcctgaacg agagcgggcg gaaaacgttc       840
     atcgaagcct acgagacccg cctgaaggag accatcaagc acccgaagct cggaaggcct       900
     gtttcctacc ggcggctcat tcgcatggag ctctacaagc tggagaagca ccttatggga       960
     gacgagccct acgagccctt cgtgagccgg tggtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page