(data stored in ACNUC7421 zone)

EMBL: CP000386.PE256

CP000386.PE256       Location/Qualifiers
FT   CDS_pept        complement(267001..267426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0260"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1791.1; KEGG:
FT                   afu:AF1862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03237"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE1"
FT                   /protein_id="ABG03237.1"
FT                   /translation="MAEERTLEQRRAAHALAAIQELQRAGRGGYGNYKSYVSSLPATIL
FT                   TNGLGQAAATLLAGAKLNSKNRNADNRAREKLYDHLSSWLCGGDEESPYQKKGDLLENI
FT                   TRNDQDCYIRAQAEALEYLSWLKRFAEAFLEGSKGEK"
     atggccgagg agagaaccct ggagcagcgc cgggcggcgc acgcgctcgc ggcgattcag        60
     gagctgcaga gagccggccg cggcgggtac ggcaactaca agagctacgt gagctcgctc       120
     ccggccacca tcctcaccaa cggtctcggc caggcggctg caactcttct tgccggagca       180
     aagctgaaca gcaagaaccg caatgcagac aatagagcac gcgagaagct ctacgatcac       240
     ctttcaagct ggctctgcgg aggagacgag gagagcccgt atcagaagaa aggtgatctg       300
     ctcgagaaca tcacccgaaa cgatcaggac tgctacatcc gggcgcaggc cgaggcgctc       360
     gagtacctct cctggctcaa gaggttcgcc gaggccttcc tcgaaggtag caaaggggag       420
     aaatga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page