(data stored in ACNUC7421 zone)

EMBL: CP000386.PE264

CP000386.PE264       Location/Qualifiers
FT   CDS_pept        complement(277018..277794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0268"
FT                   /product="CRISPR-associated protein, Cas5h family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5; KEGG:
FT                   chy:CHY_2155 CRISPR-associated protein Cas5, Hmari subtype"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03245"
FT                   /db_xref="GOA:Q1AZD3"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD3"
FT                   /protein_id="ABG03245.1"
FT                   /translation="MGQNPLLIFDLCGAYGMFRKFYTNSSSLSYPFPPRTTLAGLIAGM
FT                   MGCERDSYAEDLSLERCQIAVSVITPVRRVMQQVNYVMTEGHVWTKNTGGFDGSSGPIQ
FT                   VPVEWVFPEVGHRELRYRVYATHEDRGWLKRLAEILEGGVPIYPPYLGMSECPGRVEHV
FT                   ATLEGWGLGHREDELPVRTVLPSEAVSGPPRLEEGVQIVKERIPLALDERRRLIAAADV
FT                   LYNRAGPHITARLRAPVFEAAYPGAEGGREFGVFLR"
     atggggcaga acccgctgct aatcttcgac ctctgcgggg cgtacgggat gttccgcaag        60
     ttctacacga actcctcctc gctctcctac cccttcccgc cccgcaccac cctcgcaggg       120
     ctcatcgccg ggatgatggg ctgcgagcgc gacagctacg cagaagacct ctcgctagag       180
     cgctgccaga tcgccgtctc ggtcatcacc ccggtgcgcc gggtgatgca gcaggtcaac       240
     tacgtgatga ccgaggggca cgtctggacc aaaaacaccg gcggcttcga cggcagctcg       300
     ggcccgatac aggtcccggt cgagtgggtc ttccccgagg tgggccaccg ggagctgcgc       360
     taccgggtct acgcgaccca cgaggaccgg ggctggctta agcggcttgc ggagatcctc       420
     gagggcgggg tccccatcta cccgccctac ctggggatga gcgagtgccc gggcagggtg       480
     gagcacgtgg cgacgctcga agggtggggg ctggggcaca gggaggatga gctccccgtc       540
     cgcaccgtgc tcccctcgga ggccgtctcg gggccgccgc gcctggagga aggcgtccag       600
     atcgtgaagg agaggatccc cctcgccctc gacgagcggc ggcggctcat cgccgccgcc       660
     gacgtcctgt acaaccgcgc gggaccgcac ataaccgccc ggctgcgggc gccggtcttc       720
     gaggccgcct accccggcgc ggaggggggc cgggagttcg gggtgttcct gcgatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page