(data stored in ACNUC7421 zone)

EMBL: CP000386.PE267

CP000386.PE267       Location/Qualifiers
FT   CDS_pept        complement(280765..281538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0271"
FT                   /product="CRISPR-associated protein, Cas6 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1814; PFAM:
FT                   protein of unknown function DUF57; KEGG: tte:TTE2664
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03248"
FT                   /db_xref="GOA:Q1AZD0"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD0"
FT                   /protein_id="ABG03248.1"
FT                   /translation="MRLKIVLSGERGHLHLPLQYNSAVQGFIYANLSRTLADRLHNRGH
FT                   TYGQRRFKLFTFSRLFGRREAGEGGISFRGPVRLYLGSAEAEVLGSLAEHLLRRPETRL
FT                   GKTRCLVEEVGVEPEPEVEDGRPLLVRALSPITAYTTLATPEGRKKTYYYSPQEEEWGV
FT                   AILENIKRKVAALGWAADAEEDLREAYVRPRRVRSSDQKVLRFKGTVVKGWMGLYELKM
FT                   PEPYFRLAYDTGLGSKNSQGFGMIALPHPTEGRKR"
     atgcgtctga agatagtgtt atccggggag cggggccacc tgcacctgcc gctgcaatac        60
     aacagcgcgg tgcaaggttt catatatgcc aacctgagcc ggacgctggc cgaccggctg       120
     cacaacaggg gccataccta cggacagcgc cgcttcaagc tctttacctt ctcccgtctc       180
     ttcggcaggc gggaggcggg agaaggcggc atcagcttcc gcggtccggt gcgcctctac       240
     ctcggttcgg ccgaggcgga ggtgctgggc tccctcgccg agcacctgct caggcggccc       300
     gaaacaaggc tggggaagac gcggtgcctc gtggaggagg tgggcgtcga gcccgagcca       360
     gaggtggaag acggcaggcc cctgctcgtc agggccctct cccccatcac cgcctacacc       420
     acgctcgcca cccctgaggg caggaagaag acctactact actcgccgca agaggaggag       480
     tggggcgtgg cgatcctgga gaacataaag cgcaaggtcg cggcgctcgg gtgggcggcc       540
     gacgcggagg aggacctgcg cgaggcctac gtcaggcctc gcagggtgcg cagctcggac       600
     cagaaagtcc tgcgtttcaa gggcaccgtc gtgaagggct ggatgggcct ctacgagctg       660
     aagatgcccg aaccctactt ccggctggcg tacgacaccg ggctcgggag caagaactcg       720
     cagggcttcg ggatgatcgc gctgccccac cccaccgagg ggaggaagag gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page