(data stored in ACNUC7421 zone)

EMBL: CP000386.PE273

CP000386.PE273       Location/Qualifiers
FT   CDS_pept        287254..288663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0278"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase-like; KEGG: tfu:Tfu_0626
FT                   3-isopropylmalate dehydratase large subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03254"
FT                   /db_xref="GOA:Q1AZC4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZC4"
FT                   /protein_id="ABG03254.1"
FT                   /translation="MEKKKPRTLVEKIWERHVVRRAEGEPDLLYVDLHMVHEVTSPQAF
FT                   EALRLAGRRVRRPDLTVATMDHNVPTTDVRLGVRDRVSARQMEALRKNCEEFGIQLHEW
FT                   GSPGQGIVHVIGPEMGLTQPGMVIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTIP
FT                   QRRPKTMAITVEGEAPPDVTAKDIMLGILHRIGTGGGVGHAIEYRGEAIRNLSMEGRMT
FT                   ICNMTIEGGGRAGMVAPDEKTYSYIEGRPHAPKGRAWEEALEYWQSLPTDEGATFDKEV
FT                   VIDAAELVPYVSWGTTPAQTVPLDGEVPEPQNEGHERALRYMGLRPGTPIREIEVDTVF
FT                   IGSCTNARIEDLRAAARVLEGHKVKEGIRAMVVPGSMRVKKQAEEEGLDEIFKKAGFEW
FT                   RNAGCSMCLGMNPDILSPGERCASTSNRNFEGRQGKGGRTHLVSPVVAAATAVMGRFAS
FT                   PSELGVPVEVG"
     atggagaaga agaaacccag gacgctcgta gagaagatat gggagcgaca cgtggtgcgg        60
     cgggccgagg gggagcccga cctcctgtac gtggatctcc acatggtcca cgaggtcacg       120
     agcccccagg ccttcgaggc gctgcggctc gccggcagga gggtcaggag gcccgacctc       180
     accgtggcca ccatggacca caacgtcccg accaccgacg tgcgcctcgg ggtcagggac       240
     agggtctcgg cccggcagat ggaggcgctc aggaaaaact gtgaggagtt cgggatacag       300
     ctgcacgagt ggggctcgcc cgggcagggc atcgtgcacg tcatcgggcc ggagatgggg       360
     ctcacccagc cggggatggt catcgtctgc ggcgactccc acacctccac ccacggcgcc       420
     ttcggggccc tggccttcgg catcggcacc agcgaggtcg agcacgtgct cgccacccag       480
     accatcccgc agcgcaggcc caagaccatg gccataaccg tcgagggcga ggccccgccc       540
     gacgtgacgg ccaaggacat catgctcggc atcctgcacc gcatcggcac cggcggcggg       600
     gtcgggcacg ccatcgagta ccggggcgag gcgatccgca acctctccat ggaggggcgg       660
     atgaccatct gcaacatgac catcgagggc ggcggtcgcg ccgggatggt cgcccccgac       720
     gagaagacct actcgtacat cgagggccgc ccccacgccc cgaagggcag ggcctgggag       780
     gaggcgctcg agtactggca gagcctcccc accgacgagg gcgcgacctt cgacaaagag       840
     gtcgtcatag acgccgccga gctcgtcccc tatgtctcct ggggcaccac ccccgcgcag       900
     accgtcccgc tcgacgggga ggtccccgag ccccagaacg agggccacga gcgcgcgctc       960
     aggtacatgg gcctcaggcc cggcaccccc ataagggaga tagaggtgga caccgtgttc      1020
     atcgggtcgt gcaccaacgc caggatagag gacctgcgcg ccgcggcccg cgtgctcgag      1080
     ggccacaagg tgaaggaggg catccgtgcg atggtcgtcc ccggctccat gcgcgtgaag      1140
     aagcaggccg aggaggaggg gctcgacgag atcttcaaga aggccggttt cgagtggcgc      1200
     aacgccggct gctccatgtg cctcggtatg aacccggaca tcctctcgcc cggcgagcgc      1260
     tgcgcctcca cctcgaaccg caacttcgag gggcggcagg gcaagggcgg caggacgcac      1320
     ctcgtgagcc cggtggtcgc ggcggcgacg gcggtgatgg ggcgcttcgc ctcgccctcg      1380
     gagctcggcg tccccgtgga ggtgggctag                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page