(data stored in ACNUC7421 zone)

EMBL: CP000386.PE274

CP000386.PE274       Location/Qualifiers
FT   CDS_pept        288664..289251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0279"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: fra:Francci3_3620 3-isopropylmalate
FT                   dehydratase, small subunit; TIGRFAM: 3-isopropylmalate
FT                   dehydratase, small subunit; PFAM: aconitate hydratase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03255"
FT                   /db_xref="GOA:Q1AZC3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZC3"
FT                   /protein_id="ABG03255.1"
FT                   /translation="MEPVRKVEGKALPLGYSDVDTDQIVPSDALKRIERTGFGRFLFAE
FT                   WREDPDFVLNKPEHQGAVVLIAGENFGCGSSREHAVWAVQDYGFGAVIAPSFADIFKNN
FT                   CTKNGVLTVELPKETVRRLLEAVREDPEATVTVDLESRTVKGPGVETTFEIDDFVRYRL
FT                   LNGLDDVGLTLRHEEDIERFERSRPRYMPRVL"
     atggagcccg taaggaaggt cgagggcaag gcgctgcctt taggctactc ggacgtggac        60
     accgaccaga tagtcccctc cgacgccctc aagcgcatcg agcgcaccgg cttcgggcgg       120
     ttcctcttcg ccgagtggcg cgaggacccg gacttcgtcc tcaacaaacc cgagcaccag       180
     ggcgcggtcg tcctcatcgc cggggagaac ttcgggtgcg gctcgagccg cgagcacgcc       240
     gtctgggccg tgcaggacta cggcttcggg gccgtcatcg ccccctcctt cgccgacatc       300
     ttcaagaaca actgcacgaa gaatggcgtc ctcaccgtgg agctcccgaa ggagacggtg       360
     cggaggctgc tcgaggccgt gcgcgaggac cccgaggcca ccgtcaccgt ggacctggag       420
     agccgcaccg tgaagggccc cggcgtggag acgaccttcg agatagacga cttcgtccgc       480
     taccgcctcc tgaacggcct cgacgacgtg ggcctcaccc tgcggcacga ggaggacatc       540
     gagcgcttcg agcgctcgcg cccgcggtac atgccgcggg tgctgtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page