(data stored in ACNUC7421 zone)

EMBL: CP000386.PE277

CP000386.PE277       Location/Qualifiers
FT   CDS_pept        290468..291385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0282"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: nfa:nfa10300 putative
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03258"
FT                   /db_xref="GOA:Q1AZC0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC0"
FT                   /protein_id="ABG03258.1"
FT                   /translation="MLEVAIMIEGQDGIDWPRWKRIVRTVEDAGYAALHRSDHFTNPSG
FT                   PVKDALELWASLTWLAENTERIEFGPLVTPVSFRHPVITAWQAAAVDGLSGGRLRLGLG
FT                   AGWQEREHTAFGFELLDAERRFARFEEGLEVVTRLLRSAEPVSFEGEFYRLRGAVLLPR
FT                   PARPGGVPVVVGGNGPRRTLPLAARYADEWNGLFLDAKRFAGLSARLDEMVEEAGRRPE
FT                   EVRRSLMVRAVFGRTEARVREKLGGAPRGALEEQAAIVGTAGEFVERLGELQEAGAQRV
FT                   MLQWLETDDLEGIEELASGVLPQL"
     atgctcgagg tggccatcat gatcgagggc caggacggga tagactggcc gcgctggaag        60
     cggatcgtcc ggacggtgga ggacgcgggc tacgccgcgc tccaccgctc ggaccacttc       120
     acgaacccct ccgggccggt gaaggacgcc ctggagctgt gggcctcgct gacctggctc       180
     gcggagaaca ccgagcgcat cgagttcggg ccgctggtga cgccggtctc cttccggcac       240
     cccgtgatca cggcctggca ggccgccgcc gtggacggcc tctcgggcgg gcggctgcgg       300
     ctcggcctgg gcgcgggctg gcaggagcgc gagcatacgg ccttcggctt cgagctgctg       360
     gacgcggagc gccgcttcgc ccgcttcgag gaggggctcg aggtcgtaac gcggctcttg       420
     cggagcgcgg agcccgtctc gttcgagggg gagttctacc ggctgcgcgg cgcggtcctc       480
     cttccccgcc cggcccgccc cggcggcgtg cccgtggtcg tcggggggaa cgggccgcgc       540
     cggacgctcc ccctcgccgc ccgctacgcc gacgagtgga acggcctctt tctggacgcg       600
     aagaggttcg ccgggctcag cgcgcgcctg gacgagatgg tggaggaggc tggccggcgg       660
     cccgaggagg tgcgccgctc gctcatggtc cgcgcggtct tcgggcgcac ggaggcgcgg       720
     gtgcgggaga agctcggggg cgccccgcgg ggggcgctgg aggagcaggc cgccatagtg       780
     gggacggccg gggagttcgt cgagcggctg ggggagctgc aggaggccgg ggcgcagcgg       840
     gtcatgctgc agtggctgga gaccgatgac ctggagggca tagaggagct ggcctccggg       900
     gtgctccccc agctctag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page