(data stored in ACNUC7421 zone)

EMBL: CP000386.PE278

CP000386.PE278       Location/Qualifiers
FT   CDS_pept        complement(291382..292206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0283"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   mlo:mll7342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03259"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB9"
FT                   /protein_id="ABG03259.1"
FT                   /translation="MSLTIGTGPFGPRGGAFNFEVKAPRGHVLYFEDSPRRVRVELGGE
FT                   TVADSRRMKLLHETGLLPVYYFPEEDVRTELLERTDHTTRCPFKGEAVYWTVRAGGRTA
FT                   ENAAWAYPEPLEGAPPLGGHIAFYWDRMDRWFEEDEEVDVHPRDPYHRIDALPSSRHVR
FT                   VTVNGELVAETRRPVILFETGLPPRYYIPREDVREELLVPSESSSVCPYKGVASYWSVR
FT                   AGGETVEDLVWSYPEPRRDAERVGGLLCFFNERVDLEVDGERQERPETQWSR"
     atgtcgctga cgataggcac cggccccttc gggccgcggg gcggggcgtt caacttcgag        60
     gtgaaggccc cccgggggca cgtcctgtac ttcgaggact cccccaggcg ggtgcgggtg       120
     gagctcggcg gcgagacggt cgccgacagc cgccggatga agcttctgca cgagacgggg       180
     ctcctcccgg tctactactt ccccgaggag gacgtgcgga cggagcttct ggagaggacc       240
     gaccacacca cccgctgccc cttcaagggc gaggcggtct actggacggt tcgcgccggg       300
     ggcaggacgg cggagaacgc ggcctgggcc tacccggagc ccctggaggg ggcgccgccg       360
     ctcggggggc acatagcctt ctactgggac cggatggacc gctggttcga ggaggacgag       420
     gaggtggacg tccatcccag agacccctac caccgcatag acgccctccc gagctcccgg       480
     cacgtgaggg tgacggtgaa cggcgagctg gtggcggaga cgcggcggcc cgtgatcctc       540
     ttcgagaccg gcctgccgcc ccgctactac ataccgcgcg aggacgtgcg ggaggagctg       600
     ctcgtcccga gcgagtcctc ctcggtctgc ccgtacaagg gggtggcctc ctactggtcg       660
     gtgagggccg ggggcgagac ggtggaggat ctggtctgga gctacccgga gccccgccgg       720
     gacgccgaga gggtgggagg gctgctctgc ttcttcaacg agcgggtgga cctggaggta       780
     gacggcgagc ggcaggagcg ccccgagacc cagtggtccc gctag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page