(data stored in ACNUC7421 zone)

EMBL: CP000386.PE279

CP000386.PE279       Location/Qualifiers
FT   CDS_pept        292334..293428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03260"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB8"
FT                   /protein_id="ABG03260.1"
FT                   /translation="MSPEDGLHRLELNLHPNEASGLLAVENGGLLRLRGWDLGFWAVLD
FT                   EGGIQDCIALIGHREGAGIGEGWEIERLRAVPAGSPRKTADAEAIARRGVFVYAFGSHF
FT                   GRKDGPLQPKRGFVARFREDAVEGSASGFAAELEVYRESFRLHRLVNDALRERGPELVP
FT                   LREATRRAFVEAAVRRGREEGKAWSGMVRGGDYPLNFEGAAFRESGSLLLGLRFPTSAG
FT                   GRPVLVEMEGVERLFEGGLPEVRGFLVVDAVGRGGEMAGVRDLALVGGAGGEELHLVTG
FT                   NIDSREGESVLVRDYPEGRDTVATHFRCALPAGARSGSLPARFVREFPDLPRVEGIAVS
FT                   GDRFFYVTDEDEGVHLRLTRLLAG"
     atgtcgccgg aagacgggct gcaccggctg gagctgaacc tgcaccccaa cgaggcctcg        60
     ggcctgctcg ccgtcgagaa cggcgggctg ctccgcctgc gggggtggga cctcggcttc       120
     tgggcggtgc tggacgaggg cgggatccag gactgcatag ccctcatagg ccaccgggag       180
     ggggccggga tcggggaggg gtgggagata gagcgcctgc gggccgtccc ggcgggaagc       240
     ccgagaaaga cggccgacgc cgaggcgata gcccgccgcg gcgtcttcgt ctacgccttc       300
     ggctcccact tcggccgcaa ggacgggccg ctgcagccga agaggggctt cgtggcccgc       360
     ttcagggagg acgcggtcga gggctccgcc tccgggttcg cggcggagct ggaggtttac       420
     cgggagagct tccggctgca ccgcctcgtc aacgacgcct tgcgggagag ggggcccgag       480
     cttgtgccgc tcagggaggc cacgcgccgc gccttcgtgg aggccgccgt ccgccgcggg       540
     cgggaggagg ggaaggcctg gagcgggatg gtgcgcgggg gggactaccc gctgaacttc       600
     gagggggcgg ccttccggga gagcggctcg ctgcttttgg ggctccgctt cccgacctcc       660
     gccggaggga ggcccgtgct ggtcgagatg gagggcgtcg agcgcctctt cgagggcggg       720
     cttccggagg tccggggctt tctggtggtg gacgccgtgg gccgcggcgg ggagatggcg       780
     ggggtgcggg acctcgcgct cgtcgggggg gcggggggag aggagcttca cctggtcacc       840
     gggaacatag acagccggga gggggagagc gtcctcgtcc gggactaccc cgaaggcagg       900
     gacaccgtgg ccacccactt ccgctgtgcc ctgccggccg gtgcccgctc cgggagcctc       960
     ccggcccgct ttgtccggga gttccccgac ctgccgcggg tggagggcat cgccgtctcg      1020
     ggggacaggt tcttctacgt caccgacgag gacgaggggg tgcacctcag gctcacgcgg      1080
     ctgctcgcgg ggtag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page