(data stored in ACNUC7421 zone)

EMBL: CP000386.PE28

CP000386.PE28        Location/Qualifiers
FT   CDS_pept        30831..31817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B019"
FT                   /protein_id="ABG03009.1"
FT                   /translation="MRVLPAWLTMLGSLLFLFVVLAFIFLVARGCIATQESTQIRKYVT
FT                   GADSLLSDSSDLGNGQLQPALKRAGGEPGRVSREALSRVADRSEDLYRRALENDEVPPE
FT                   FDDAHHYLVSALGIRAQATARLASAAGGDGGRFQQALAEAVESFRISDGIVRNHYIPAV
FT                   GDALQEAGHGRDRVYLEEPEPFMDYEEVGFEAGGASVPAQDDPNALHGVEIVSVTVAGQ
FT                   PLYPGGNVVLTGSDEPVFSVTVANGGEVPETAVPVEVILNTRAERQARTVTIERIEPGG
FT                   GQATVEVSGFRPGQLNETAEVTVKAGPVEYEDYTQNNTLTGTVTFGM"
     atgcgggtcc ttccggcctg gctgacgatg ctgggctccc tgcttttcct gtttgtggtg        60
     ctggccttta tcttcctggt ggcccgcggc tgcatcgcca cccaggagtc cacccagatc       120
     cgcaagtacg tcacgggcgc cgacagcctg ctgagcgact cctcggattt gggcaacggc       180
     cagctgcagc cggcgctcaa gcgggccggg ggggagccgg ggcgggtgag ccgggaggcg       240
     ctctcccggg tcgccgaccg ctcggaggac ctctaccggc gcgccctgga gaacgacgag       300
     gtgcccccgg agttcgacga cgcccaccac tacctggtca gcgccctggg cattcgggcg       360
     caggccaccg cccggctggc ctcggccgcc gggggggacg gggggcgctt ccaacaggcg       420
     ctggccgagg cggtggagag cttcaggatc agcgacggca tcgtccgcaa ccactacata       480
     ccggcggttg gcgacgcgct ccaggaggcc gggcacgggc gcgacagggt ctacctggag       540
     gagcccgagc cgtttatgga ctacgaagag gtgggcttcg aggcgggcgg ggcctccgtt       600
     ccggcccagg acgacccgaa cgccctgcac ggggtggaga tagtctccgt cacggtcgcc       660
     gggcagccgc tgtatccggg cggcaacgtg gtgctcaccg gctccgacga gcccgtcttc       720
     agcgtcaccg tggccaacgg gggggaggtg ccggagacgg ccgtgcccgt cgaggtgatc       780
     ctgaacaccc gcgccgagcg ccaggccagg acggtcacca tcgagcggat agagcccggc       840
     ggggggcagg ccacggtcga ggtctccggg ttcaggcccg ggcagctcaa cgagaccgcc       900
     gaggtgaccg tcaaggcggg gccggtggag tacgaggact acacgcagaa caacacgctc       960
     accggcacgg tgacgttcgg gatgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page