(data stored in ACNUC7421 zone)

EMBL: CP000386.PE280

CP000386.PE280       Location/Qualifiers
FT   CDS_pept        293446..294843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03261"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB7"
FT                   /protein_id="ABG03261.1"
FT                   /translation="MGAGGRSAGRTRLRRVLLFVLAGAALSAALLALFFWPWVAAQVRA
FT                   VVVLAAVLRPPALSPAVAALTPEPALSDREVAGVPTLVARPAGAGEGPALVFVNGAVPP
FT                   GRHEPNVRRLARGLARAGYQVYVPDVPGLRSGEISPSTVEATVGVARRAAEGSESGRVG
FT                   LAGVSVGASIALLAAEDPRINDRVSVVSGIAPYTDLKTVLRLATTGTYLRGGEPVPYRT
FT                   PPYLRLVVARSLVSMLPPGEDRRALMRRLPSLESYYPPRLVDDDPLAPLRAFVAARGGE
FT                   LGPAAESAARLLVNEDPARFEELFAALPPRLERLVGVLSPLAGAERLRAPVYIASAPRD
FT                   KYFPLVESRRLARASPRVDLTVTRTLVHAIPRPSPGDLAAFARLDAFVVRSLRASAQGA
FT                   PQGGQQDAGLEQGLRGGEQVLHLQQPPGRPLVLGGQPQHPFRDPVGEPPEGAQLLDARG
FT                   RRPLGVA"
     gtgggcgcag ggggccgaag cgcggggaga acgaggctcc gcagggtcct gctcttcgtg        60
     ctggccgggg cggcgctctc cgcggctctc ctcgccctct tcttctggcc gtgggtcgcg       120
     gcgcaggttc gggcggtggt ggtgctcgcc gccgtcctcc ggccgccggc gctctccccg       180
     gcggtggcgg ctctcacccc cgagcccgcc ctctccgacc gcgaggtggc cggggtgccc       240
     accctggtgg cccgccccgc gggggcgggg gaggggccgg cgctcgtgtt cgtgaacggg       300
     gccgtccccc cggggcgcca cgagcccaac gtccggcggc tcgcccgggg gctcgcccgg       360
     gccggctacc aggtctacgt cccggacgtg ccgggcctga ggagcggcga gatctccccg       420
     tccaccgtgg aggcgacggt gggggtggcc cgccgggcgg cggagggctc cgaaagcggc       480
     cgggtcgggc tcgcgggggt ctcggtgggg gcctccatcg cgcttctggc cgccgaggac       540
     ccccgcataa acgaccgggt ctccgtcgtc tccgggatag cgccctacac cgacctgaag       600
     accgtcctgc ggctcgccac caccggcacc tacctgcgcg gcggcgagcc cgtcccctac       660
     aggacgccac cctacctgcg gctggtggtc gcccgctcgc tggtctccat gctccccccc       720
     ggcgaggacc ggcgggccct gatgcgccgc ctgccctccc tggagagcta ctacccgccg       780
     cgcctggtgg acgacgaccc gctcgcgcct ctgcgcgcct tcgtcgccgc gcgcggcgga       840
     gagctcggcc cggcggcgga gagcgccgcc aggctcctcg tcaacgagga cccggcgcgc       900
     ttcgaggagc tcttcgccgc cctccccccg cgcctcgagc ggctggtggg cgtcctctcg       960
     ccgctcgccg gggcggagag gctccgggcg ccggtgtaca tagcctccgc cccccgcgac      1020
     aagtacttcc cgctcgtcga gtcgcgccgg ctggcccggg cctccccgcg ggtggacctg      1080
     acggtcaccc ggacgctcgt ccacgccatc ccccgcccct cccccggcga tctcgccgcc      1140
     ttcgcccggc tcgacgcctt cgtggtccgg tcgctgcggg cctcagccca aggcgcgccg      1200
     cagggcgggc agcaggatgc cgggctcgag cagggcctgc gggggggcga gcaggttctt      1260
     cacctccagc agcctccggg ccgcccgctc gtcctcggtg gccagccgca gcaccccttc      1320
     cgagacccgg tgggcgagcc gccggagggg gcccagctcc ttgacgctcg aggccgccgc      1380
     ccactgggcg tcgcttga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page