(data stored in ACNUC7421 zone)

EMBL: CP000386.PE293

CP000386.PE293       Location/Qualifiers
FT   CDS_pept        complement(307196..307819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03274"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA4"
FT                   /protein_id="ABG03274.1"
FT                   /translation="MEERGLAGLEARTPEGEPLGRIAEAVRDEESGAVTRVIVERDGER
FT                   YEVPVADIAVDSEAELATLSPREGPEGYAPSRGGEEERPHAGQFVTEPVSEAEAEPPEE
FT                   LAREDWEDEASTSVDSGYPRTDAYIDPDTGEEEVEPRMQESEDLRAEVEELLADTDLEV
FT                   GAIRDGVVELTGSVETQEDLEAIVEELMGIPEVLEVDTTDVEVG"
     atggaggagc gaggtctggc ggggctcgag gcgcggacgc cggagggcga gcccctcggc        60
     cggatagcgg aggccgtacg cgacgaggag agcggcgcgg tgacgcgggt gatcgtggag       120
     cgggacggcg agcgctacga ggttccggtc gcggacattg cggtggacag cgaggcggag       180
     ctcgccacgc tgagcccgcg ggaggggccg gagggctatg ccccttcgcg gggcggggag       240
     gaggagcggc cgcacgcggg ccagttcgtc acggagccgg tgagcgaggc cgaggccgag       300
     ccgccggagg agcttgcgcg ggaggactgg gaggacgagg cctcgaccag cgtggactcc       360
     ggctacccgc gcacggacgc gtacatagac cctgacaccg gagaagagga ggtggaaccg       420
     aggatgcagg agagcgagga tctcagggcc gaggtggagg agcttctcgc ggacacggat       480
     ctggaggtgg gggccatccg ggacggggtg gtggagctga ccggctcggt ggagacccag       540
     gaggatctgg aggccatcgt cgaggagctc atgggcatcc ccgaggtgct ggaggtggac       600
     accaccgacg tggaggtggg ctag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page