(data stored in ACNUC7421 zone)

EMBL: CP000386.PE294

CP000386.PE294       Location/Qualifiers
FT   CDS_pept        308173..310686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0299"
FT                   /product="ATPase AAA-2"
FT                   /note="PFAM: UvrB/UvrC protein AAA ATPase, central region
FT                   Clp, N terminal ATPase associated with various cellular
FT                   activities, AAA_5 ATPase AAA-2; SMART: ATPase; KEGG:
FT                   tte:TTE2327 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03275"
FT                   /db_xref="GOA:Q1AZA3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA3"
FT                   /protein_id="ABG03275.1"
FT                   /translation="MLHNLLQQHAQGPGSLFEALSREAQEAVMRAREASAGAGGEAAIG
FT                   TDHLLAGIVAGDNLATEALRRAGADVEGMRAKFREQRGDPGEKVYTFTPSAKRALQLSF
FT                   TAARQMGAPQVGAEHLLLGLLGEGDGNAYRILSQHGAGDAEALRREILRLLQQRGGQVG
FT                   AGMPGAAPGGPGMPGGPQGPQSRTPTLDQVSRDLTRMARDGELDPVIGRAGEIARVVRI
FT                   LSRRTKNNPVLIGEAGVGKTAIAEGLAQRIVSEDVPEVLKGKRVVALDVGALVAGTRFR
FT                   GDFEERMKQLLNELQREEKNIILFIDELHTIVGAGGAEGAVTASNMLKPALARGELQVV
FT                   GATTLDEYRKHVEKDPALERRFQPVLVEEPTVDETIAILFGLRDRYEAHHRVRISDEAI
FT                   IAAAQLSERYITDRFLPDKAIDLLDEAAAEVRLRSTVPPVDLKRIEEEIASLENQKEDA
FT                   VRAEDYERAAQYKQRIEQLKLELREKQEGWAGNREANAPEVRREDIARILEEWTGIPAT
FT                   NIVQEEAERLLNLEAVLHERVIGQDEAVRAVAEAIRRARAGIKDPRRPVGSFIFLGPTG
FT                   VGKTELARTLAEYLFGEEEAMVRIDMSEYQEKHTVSRLVGAPPGYVGYEEAGQLTEQIR
FT                   RRPYSVVLFDEIEKAHPDIFNTLLQILDDGRLTDAQGRTVDFRNAVIIMTSNVGSQHLV
FT                   SERQFGFTAREGVDFREMERRARNALEQTFRPEFLNRVDEIIVFRPLSKEDVMQIVDIM
FT                   LRRLNKHLESQRISVEVTPEAREFLAEEGYDPKFGARPLSRAIRRHIENPLSSSIIEGE
FT                   FSPGDTVVVDRDGDRLTFRAKAPVS"
     atgttgcaca acctgcttca gcagcacgcg cagggtcccg gcagcctctt cgaggcgctc        60
     tcccgggagg cgcaggaggc cgtgatgcgc gcccgggagg cctccgccgg ggccggcggg       120
     gaggcggcca tcgggaccga ccacctgctg gccgggatcg tcgccggcga caacctggcc       180
     accgaggcgc tgcggcgggc cggggccgac gtggagggca tgcgggccaa gttccgcgag       240
     cagcggggcg acccggggga gaaggtctac accttcaccc cgagcgccaa gcgggcgctg       300
     cagctctcct tcaccgcggc gcggcagatg ggcgcgccgc aggtcggcgc cgagcacctg       360
     ctgctcgggc tgctcggcga gggcgacggc aacgcctacc gcatcctctc ccagcacggc       420
     gcgggggatg ccgaggcgct gcggcgcgag attttgcgcc tgctgcagca gcgcggcggt       480
     caggtgggcg ccgggatgcc cggcgcggcc cccggcggtc ccggcatgcc cggcggcccg       540
     caggggccgc agagccggac cccgaccctc gaccaggtca gccgcgacct cacgcggatg       600
     gcccgcgacg gcgagctcga ccccgtcatc ggcagggccg gcgagatagc gcgggtggtg       660
     cgcatcctct cgcggcgcac caagaacaac cccgtgctca tcggcgaggc cggcgtgggg       720
     aagaccgcca tcgccgaggg gctggcgcag cggatagtct ccgaggacgt gcccgaggtg       780
     ctcaagggca agcgggtcgt cgccctcgac gtcggcgcgc tggtggccgg cacccgcttc       840
     cgcggggact tcgaggagcg gatgaagcag ctcctcaacg agctgcagcg ggaggagaag       900
     aacatcatcc tgttcatcga cgagctgcac accatcgtcg gcgcgggtgg cgccgagggg       960
     gcggtgaccg cctccaacat gctcaagccc gcgctcgccc gcggcgagct gcaggtcgtc      1020
     ggggcgacca ccctcgacga gtaccgcaag cacgtcgaga aggacccggc gctcgagcgg      1080
     cgcttccagc cggtcctggt cgaggagccc acggtggacg agaccatcgc catcctcttc      1140
     gggctcaggg accgctacga ggcgcaccac cgggtccgga tctcggacga ggccatcatc      1200
     gccgccgcgc agctctccga gcggtacatc accgaccgct tcctgccgga caaggccata      1260
     gacctgctgg acgaggcggc cgccgaggtg cgcctgcgct ccaccgtccc tccggtggac      1320
     ctcaagagga tcgaggagga gatagcctcg ctcgagaacc agaaggagga cgcggtgcgg      1380
     gccgaggact acgagcgggc cgcccagtac aagcagcgca tagagcagct caagctcgag      1440
     ctgcgcgaga agcaggaggg ctgggccggc aaccgggagg ccaacgcccc ggaggtccgg      1500
     cgggaggaca tcgcccgcat cctggaggag tggaccggca tcccggccac caacatcgtc      1560
     caggaggagg ccgaacgcct cttgaacctg gaggccgtcc tgcacgagcg ggtcatcggc      1620
     caggacgagg ccgtgagggc cgtcgccgag gccataaggc gcgcccgcgc ggggataaag      1680
     gaccccaggc ggccggtcgg gagcttcatc ttcctcgggc ccacgggcgt ggggaagacg      1740
     gagcttgcgc gtacgctcgc cgagtacctc ttcggcgagg aggaggcgat ggtgcgcatc      1800
     gacatgagcg agtaccagga gaagcacacc gtcagccggc tcgttggcgc gcccccgggc      1860
     tacgtgggct acgaggaggc cgggcagctc accgagcaga tccggcgcag gccctactcg      1920
     gtggtgctct tcgacgagat agagaaggcc cacccggaca tcttcaacac gctgctgcag      1980
     atcctggacg acgggcgcct caccgacgcc cagggccgga cggtggactt ccgcaacgcg      2040
     gtcatcatca tgacctccaa cgtggggagc cagcacctgg tctccgagcg gcagttcggg      2100
     ttcaccgcgc gcgagggcgt ggacttccgg gagatggagc gccgggccag gaacgccctg      2160
     gagcagacct tccgcccgga gttcctgaac cgggtcgacg agatcatcgt cttccgcccg      2220
     ctctcgaagg aggacgtgat gcagatcgtg gacatcatgc tccggcggct gaacaagcac      2280
     ctggagagcc agcggatctc cgtggaggtg accccggagg cccgggagtt cctggccgag      2340
     gagggctacg acccgaagtt cggcgcgagg ccgctctccc gcgcgatccg gcggcacata      2400
     gagaacccgc tctcgagcag catcatcgag ggcgagttca gcccgggcga cacggtggtg      2460
     gtggaccgcg acggcgaccg gctgaccttc agggcgaagg ccccggtctc ctga            2514
//

If you have problems or comments...

PBIL Back to PBIL home page