(data stored in ACNUC7421 zone)

EMBL: CP000386.PE297

CP000386.PE297       Location/Qualifiers
FT   CDS_pept        313672..315426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0302"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; KEGG: gme:Gmet_2460 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03278"
FT                   /db_xref="GOA:Q1AZA0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA0"
FT                   /protein_id="ABG03278.1"
FT                   /translation="MSSPAHRGPGPPGARRSGLPGGLRSRAAAHLRKAALPYAVLALAL
FT                   AFTLLAWEYVRQNLEERDRDLFRNTVSAAELAVERRTRGHILALYGARALFIPGGEVDA
FT                   RDWERYVRSVRLRERFGGLLILGYAPRAPGGRERFPVRLAGPEDEAGRLLLGYDPYADP
FT                   EHRAAMERARDGGVPQATGMVYVPSEAPPGSVLDILLRRGFYVYLPVYRGGEDPGSPAD
FT                   RRRALEGFVVGIFEMEGLMRGIFRGDFAPAVDLEVYDGGRTSPEALLYDGDGVLRASDP
FT                   SAAPRFAGSSRLSVGGRRWTLFSAALPGFAGGDGALLPPLVLAVGGATGGLLFGATWLL
FT                   ASSRLRAQAAGRKLEEANRELEAFSYSVSHDLRAPLRSIEGFSQILLEDYGERLDAEGR
FT                   DYLNRVRRASQRMALLIDALLGLSRLGRREVRLARVDLSRMAREIVEELRQREPGREVE
FT                   VRVEDGLEATADPGLVKVALENLLGNAWKFTAREERAVIEFGRAVREREPGRPLSCYYV
FT                   RDNGVGFDMAYAGKLFGPFQRLHTEEEFEGTGVGLATVWRVVRRHGGVIWAEAAEGEGA
FT                   AFYFTLSP"
     gtgtcgtccc cggcgcaccg cgggccgggc ccgccgggag caagaaggtc tggcctgccg        60
     ggcgggctgc gctcgcgggc cgccgctcac ctgcgcaagg cggccctccc ctacgcggtg       120
     ctggccctgg cgctggcgtt caccctgctc gcctgggagt acgtccggca gaacctggag       180
     gagcgggaca gagacctctt ccggaacacc gtctcggccg cggagctcgc cgtcgagcgc       240
     cgcacccggg ggcacatcct ggcgctgtac ggggcgcggg cgctgttcat cccgggcggg       300
     gaggtggacg cccgcgactg ggagcgctac gtccggagcg tgaggctccg ggagcggttc       360
     ggggggctcc tcatcctcgg ctacgccccg cgcgcccccg gcggacggga acgcttcccg       420
     gtgcgcctcg ccggacccga ggacgaggcc ggccggctgc tgctcggcta cgacccctac       480
     gccgaccccg aacaccgggc cgccatggag cgggcgcggg acgggggcgt cccccaggcc       540
     accggcatgg tctacgttcc ctccgaggcc ccgccgggct cggtgctgga catactgctg       600
     cgccgggggt tctacgtgta cctgccggtc taccgcggcg gggaggaccc cggaagcccc       660
     gcggaccggc ggcgggccct ggagggcttc gtggtcggga tcttcgagat ggagggcctg       720
     atgcgcggga tcttccgggg ggacttcgcg cccgccgtgg acctggaggt ctacgacggc       780
     ggccgcacct ccccggaggc cctgctctac gacggggacg gggtgctgcg cgcctccgac       840
     ccctcggccg cgccccggtt cgccggctcc tcccgcctct ccgtcggggg ccggcggtgg       900
     accctcttct ccgccgccct cccgggcttc gccggggggg acggggccct cctgccgccg       960
     ctcgtgctcg ccgtcggcgg ggcgacgggc gggctgctct tcggggcgac ctggctgctc      1020
     gcctccagcc gtctgcgcgc ccaggccgcg ggccgcaagc tggaggaggc caacagggag      1080
     ctggaggcct tcagctactc ggtctcccac gacctgcgcg cccccctgcg cagcatcgag      1140
     gggttctccc agatcctgct ggaggactac ggggagcgcc tggacgcgga gggcagggac      1200
     tacctgaacc gcgtgcggcg ggcgagccag cggatggccc tgctcatcga cgccctgctc      1260
     ggcctctcgc gcctcggcag gagggaggtg cgcctcgccc gggtggacct ctcccgcatg      1320
     gcccgcgaga tagtagagga gctgcggcag cgggagcccg ggcgcgaggt ggaggtgcgc      1380
     gtggaggatg ggctcgaggc gacggccgac cccgggctcg tcaaggtggc gctcgagaac      1440
     ctgctcggca acgcctggaa gttcaccgcc agggaggagc gggccgtcat agagttcggc      1500
     cgcgccgtgc gcgagaggga gccggggcgc ccgctctcct gctactacgt ccgggacaac      1560
     ggggtcggct tcgacatggc ctacgccggc aagctcttcg gtcccttcca gcggctgcac      1620
     accgaggagg agttcgaggg gaccggggtg gggctggcca ccgtgtggcg ggtcgtccgg      1680
     cggcacgggg gcgtgatctg ggccgaggcc gccgagggag agggggcggc cttctacttc      1740
     accctctcgc cctga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page