(data stored in ACNUC7421 zone)

EMBL: CP000386.PE298

CP000386.PE298       Location/Qualifiers
FT   CDS_pept        complement(315405..316088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ99"
FT                   /protein_id="ABG03279.1"
FT                   /translation="MAEGGFRLPGCSYEELVNIIIAYGTRDSAASPGDVGKLNAVHQSS
FT                   ASRTNGFLVEIGVLTGERERLVTRRGRELALALARKDAEGVRRAWRALVSSSEFLQNVV
FT                   SAVKLREGMLYPTLQAYVAHAAGQPRNKPVMTGAGTVIEILKAAGLLREEAPGQLTAAL
FT                   EDGQGEEPEGPGEPEKRPAEVTLEAGSGPSLSIHLHIRCGAGELDEVVPRLKELLRELQ
FT                   GERVK"
     atggcagagg gaggcttcag gctcccgggc tgctcttacg aggagctggt gaacataatc        60
     atcgcctacg gcacccggga ctcggcggcc agccccgggg acgtgggcaa gctgaacgcc       120
     gtccaccagt cgagcgccag ccggaccaac gggttcctgg tggagatcgg ggtgctgacc       180
     ggggagcgcg agcggctggt gacccggcgc gggagggagc tcgcgctcgc gctggcccgc       240
     aaggacgcgg agggggtccg ccgcgcctgg cgcgccctcg tctcctccag cgagttcctg       300
     cagaacgtgg tctcggcggt gaagctgcgc gaggggatgc tctacccgac gctgcaggcc       360
     tacgtcgccc acgcggcggg gcagccgcgc aacaagccgg tgatgaccgg ggcggggacg       420
     gtgatcgaga tcctcaaggc cgccgggctg ctgcgggagg aggcccccgg gcagctgacg       480
     gccgcgctcg aggacgggca gggggaggag ccggagggcc ccggcgagcc ggagaagcgg       540
     cccgcggagg tcacgctgga ggcgggctcc ggcccctcgc tgagcatcca cctgcacatc       600
     cgctgcgggg ccggggagct ggacgaggtc gtgccgcgcc tgaaggagct gctgcgcgag       660
     cttcagggcg agagggtgaa gtag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page