(data stored in ACNUC7421 zone)

EMBL: CP000386.PE299

CP000386.PE299       Location/Qualifiers
FT   CDS_pept        316256..316705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0304"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   dde:Dde_1416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03280"
FT                   /db_xref="GOA:Q1AZ98"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ98"
FT                   /protein_id="ABG03280.1"
FT                   /translation="MALRQKTAPTLAGLPRAEPAASRLPGLLLAALGALLIVLSAPDLA
FT                   SGAVLGGREGETLRGGLRGEALAGLSGGDALWGLGGGDLLLGGSGDDELYGGAGTDVLL
FT                   GGPGADFVEAADGEPDRILCGSGRDVASADRLDRLDSGCETVYRG"
     ttggcgctga gacagaagac cgcccccacg ctcgccgggt tgccacgcgc cgagcccgcc        60
     gcctcccggc tgcccgggct cctgctcgcc gccctggggg cgctcctcat cgtcctctcc       120
     gcccccgacc tcgcctccgg cgcggtgctc ggcggccggg agggcgagac gctgcggggc       180
     ggcctgcggg gcgaggcgct cgccggcctc tccgggggcg acgccctctg ggggctcggg       240
     ggcggggacc tgctcctcgg ggggagcggg gacgacgagc tctacggcgg cgccgggacc       300
     gacgtgctgc tgggcgggcc gggggcggac tttgtggagg cggccgacgg cgagccggac       360
     cgcatcctct gcggctccgg ccgggatgtg gccagcgccg accgcctcga caggctcgat       420
     tccggctgcg agaccgtcta ccggggctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page