(data stored in ACNUC7421 zone)

EMBL: CP000386.PE30

CP000386.PE30        Location/Qualifiers
FT   CDS_pept        complement(32128..33258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0030"
FT                   /product="Enzymatic protein of unknown function"
FT                   /note="TIGRFAM: Enzymatic protein of unknown function;
FT                   PFAM: glutamate--cysteine ligase, GCS2; KEGG: gvi:gll2294
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03011"
FT                   /db_xref="GOA:Q1B017"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1B017"
FT                   /protein_id="ABG03011.1"
FT                   /translation="MPVEFKLGNSGYTLGVEEELCIVDASTGELVPKIEEIMSRLPEDL
FT                   AEAVSYELFQSVLEIKTPVCRTVGEAERVLRELRGRVGSWTAACGASLASAGTHPFSRY
FT                   RDQKVTEHERYRQVIEELRWVATREVIFGQHVHVAVPGPEEAIQAHNRLAEQAPLLLAL
FT                   SANSPYWQGMDTGFESSRVQIFETFPRAGMPPAFPEYAAFEAYVDLMVECGAMDDYTFC
FT                   WWDVRPHPKLGTIELRVLDSQTHLRHAVALTALTQCIVASSLEDEDAPKGPYHRDIALE
FT                   NKWRASRRGLDAAFFDVDERRNVPARDLARAAVERLRPHAQQLGCEEELLGVLEIVEGG
FT                   SGSRRQREIYEKSGDFLDVVAFLIEGTRPALAGEPS"
     atgcccgtgg agttcaagct cggcaactcg ggctacaccc tgggggtcga ggaggagcta        60
     tgcatcgtcg acgcgtcgac cggcgagctc gtgcccaaga tagaggagat catgagccgc       120
     ctgccggagg atctcgccga ggcggtctcc tacgagctgt tccagtcggt gctggagata       180
     aagaccccgg tctgccgcac ggtcggggag gccgagcggg tgctgcggga gctgcggggg       240
     cgcgtgggct cctggacggc ggcctgcggg gcctcgctgg cctccgccgg gacccacccc       300
     ttcagccgct accgggacca gaaggtcacc gagcacgagc ggtaccggca ggtcatagag       360
     gagctgcgct gggtggccac gcgggaggtg atcttcggcc agcacgtcca cgtggcggtc       420
     ccggggccgg aggaggcgat ccaggcccac aaccgcctgg cggagcaggc gcccctgctg       480
     ctggccctct cggccaactc cccctactgg caggggatgg acaccggctt cgagtcgagc       540
     cgggtccaga tcttcgagac cttcccgcgc gccgggatgc cccccgcctt cccggagtac       600
     gccgccttcg aggcctacgt ggacctgatg gtggagtgcg gggcgatgga cgactacacg       660
     ttctgctggt gggacgtgag gccccacccg aagctgggca ccatagagct gcgcgtgctg       720
     gactcccaga cccacctgcg gcacgcggtg gccctgacgg cgctcaccca gtgcatcgtg       780
     gccagctcgc tggaggacga ggacgccccc aaaggcccct accaccgcga catcgccctg       840
     gagaacaagt ggcgcgcctc ccgcaggggc ctcgacgccg cctttttcga cgtggacgag       900
     cgcagaaacg tgccggcccg agacctcgcc cgcgccgccg tcgagaggct caggccccac       960
     gcccagcagc tcggctgcga ggaggagctt ctgggggtgc tggagatagt cgaggggggc      1020
     agcggcagcc gcaggcagcg cgagatctac gagaagagcg gcgactttct ggacgtggtg      1080
     gccttcctca tcgagggaac ccggcccgcc ctcgcggggg agccgagcta g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page