(data stored in ACNUC7421 zone)

EMBL: CP000386.PE304

CP000386.PE304       Location/Qualifiers
FT   CDS_pept        complement(322484..324526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0309"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: protein of unknown function DUF839; KEGG:
FT                   tfu:Tfu_2294 phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03285"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ93"
FT                   /protein_id="ABG03285.1"
FT                   /translation="MEKSSGAGRALPVLSHAGGRSAMTCAYRCGNACAHEAPNASDNPY
FT                   FGDVLSRALSRRGFLKLGAAAAVVLYAGARPAGARRRSGLTFEPVPPNSLDDVVVPDGY
FT                   DYEVVVRWGDPILPGAPEFDFENQTAEAQSKQFGYNCDYVAFFPLRGRDGGRALLVVNH
FT                   EYTNTELMFRGFDPATGTSPEDPERIRVELMAHGISVVEVRRRRRGGYEMVRSRRYNRR
FT                   ITAMTPMRLTGPAAGHEWLRTEADPEGRTVLGCLNNCAGGLTPWGTYLSGEENYNQYFV
FT                   NAGAVEDPEKRASYERYGFGATLPDFGYRGWERVEERFDLARHPNEGFRFGYVVEVDPF
FT                   DPDSVPRKHTALGRVKHEGAETTLSRDGRAVSYMGDDERFEYVYKFVSSRKMARGSSRR
FT                   AREHNLALLEEGTLYVARFSGDSPPQEIDGSGELPSDGAFDGTGEWVPLVSGEESFVPG
FT                   MSAAEVLINTRLAADRVGATKMDRPEDIQRNPVNDRVYAALTNNTRRTAADEANPRTNN
FT                   KHGHVLEISEEGDDPAATRFRWRVFLLCGDPDDPSTYFAGYDKDQVSPISSPDNLAFDE
FT                   RGNLWIATDSGGALGQNDGFFAVPVEGPERGYLRQFLTVPVGAEACGPRITPDQRTIFC
FT                   AVQHPGEVDGASPDNPASRWPDGGQPRPSVVSVFKTGRGERRIGS"
     gtggagaaga gttccggggc agggagggcc ctgccggtac tgagccacgc cgggggccgc        60
     tcggcgatga cctgcgccta ccgctgcggg aacgcctgcg cccacgaggc gcccaacgcc       120
     agcgacaacc cgtacttcgg cgacgtcctg agccgggcgc tgagccgcag gggcttcctc       180
     aagctcgggg cggcggcggc cgtcgtcctg tacgcgggcg cgcgccccgc gggggcccgg       240
     cgcaggagcg ggctcacctt cgagccggtg ccgcccaaca gcctcgacga cgtggtcgtg       300
     ccggacggct acgactacga ggtcgtcgtg cggtggggcg acccgatcct gccgggcgcc       360
     cccgagttcg acttcgagaa ccagaccgcc gaggcccaat ccaagcagtt cggctacaac       420
     tgcgactacg tggccttctt ccccctgcgc gggcgcgacg gcgggcgggc cctgctcgtc       480
     gtaaaccacg agtacaccaa caccgagctg atgttccgcg gcttcgaccc cgccacgggc       540
     acctccccgg aggaccccga gcgcatccgg gtcgagctca tggcccacgg catctccgtc       600
     gtcgaggtcc gcaggcggcg caggggcggc tacgagatgg tgcgctcccg gcgctacaac       660
     cgccgcatca ccgcgatgac cccgatgcgg ctcaccggcc cggcagccgg gcacgagtgg       720
     ctgcgcaccg aggccgaccc cgagggccgt acggtgctcg ggtgcctcaa caactgcgcc       780
     ggcggcctca ccccctgggg cacctacctc tccggcgagg agaactacaa ccagtacttc       840
     gtcaacgccg gggccgtgga ggaccccgaa aagcgcgcct cctacgagcg ctacggcttc       900
     ggcgcgacgc ttccggactt cggctaccgc ggctgggagc gcgtcgagga gcgcttcgac       960
     ctcgccaggc accccaacga gggcttccgg ttcggctacg tcgtcgaggt cgacccgttc      1020
     gacccggact ccgtgccgcg caagcacacc gcgctcgggc gcgtcaagca cgagggcgcc      1080
     gagaccacgc tctcccgcga cgggcgggcc gtctcgtaca tgggcgacga cgagcgcttc      1140
     gagtacgtct acaagttcgt cagctcccgc aagatggcga ggggcagcag ccggcgcgcc      1200
     cgggagcaca acctcgccct gctcgaggag gggaccctgt acgtcgcccg cttcagcggc      1260
     gacagcccgc cgcaggagat agacggcagc ggagagctgc cctccgacgg ggccttcgac      1320
     gggaccggcg agtgggtgcc gctcgtcagc ggcgaggaga gcttcgtgcc cgggatgagc      1380
     gcggcggagg tgctcatcaa cacccggctc gccgccgaca gggtgggcgc gaccaagatg      1440
     gaccgcccgg aggacatcca gcgcaacccc gtcaacgaca gggtctacgc cgcgctcacc      1500
     aacaacaccc ggcgcaccgc ggcggacgag gccaaccccc gcaccaacaa caagcacggg      1560
     cacgtgctgg agatctccga ggagggcgac gacccggcgg cgacccgctt ccgctggagg      1620
     gtcttcctgc tctgcggcga ccccgacgac ccctccacct acttcgccgg ctacgacaag      1680
     gaccaggtca gccccatctc ctcgccggac aacctcgcct tcgacgagcg ggggaacctc      1740
     tggatcgcca cggacagcgg cggggcgctc gggcagaacg acggcttctt cgccgtcccc      1800
     gtcgagggcc ccgagcgggg ctacctgcga cagttcctca ccgtccccgt aggggccgag      1860
     gcctgcgggc cgcgcatcac ccccgaccag aggaccatct tctgcgccgt gcagcacccc      1920
     ggcgaggtgg acggcgcctc gcccgacaac cccgcgagcc gctggcccga cggcggccag      1980
     ccccgcccct cggtcgtgag cgtcttcaag accggccgcg gcgagaggcg catcgggagc      2040
     tga                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page