(data stored in ACNUC7421 zone)

EMBL: CP000386.PE306

CP000386.PE306       Location/Qualifiers
FT   CDS_pept        complement(326295..328904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0311"
FT                   /product="Glycogen debranching enzyme-like protein"
FT                   /note="KEGG: tac:Ta0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03287"
FT                   /db_xref="GOA:Q1AZ91"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ91"
FT                   /protein_id="ABG03287.1"
FT                   /translation="MAPPLFSRRLAWGFFTALALLLPALPASAQGAPDSPTLSVSERLE
FT                   ERRYVTTGERAYVVGTEDGRFPAMGFHTRGEMGGVWSPPIKLLDGIWFGVDGEWLPPAT
FT                   RFTSGYGYVRMELPGREGLAVTRTDFVPDGLRAALFGLTFSAETEQSLTLKVDAHSELM
FT                   GAYPWGETTPSQKTYNLEDSVSVEHGRLVFRERGTPPAENALPHDWAAVVGSSLEPSGS
FT                   DTGEDFRGPQDPPVICPASPEEAPDRCDDTAYGKGKGGQLRYEITVPAGETRTVWFAVA
FT                   GADFDGEASDGEAPEDAVAAAIEEHEAALADPEALLEEKVSGRLALARYTSLDLPGDRR
FT                   LERGIEWSKQNLADSVQAAEDLEIRETNAGQSYPAPEGELDRARFLGAGFPDYQWLFAT
FT                   DGEYTAFASVAAGQFEPIKDHLRALRDVSEIDNGGSGKVVHEVVTDGSVYFGSNADPGN
FT                   TDETAKFPSAVALVWRWTGDDAFRDEMYGFARRNMHYIFRELDEDGDLWPEGLGNVERE
FT                   GMGEEKLDNAVYTIRGLYDLADMARSRGDEETERWAVKRTRAMERRFERAWWFGREGAT
FT                   QYADSLRNPGNERVFQRHWIGATPMEVELVDRRGETVPGLASREHGLAALRERELACYT
FT                   DRFGMYHTGTGPTAAGGGNPGASCDEHVSEVPSERSIFTLNTAVMAVGEGNYGRLGEDQ
FT                   QRHYTGANAALQLIPDEQPGAMPEIAPSPDYGRSIDRPLNERAMVLQAWGAYGTLWPIV
FT                   HQWLGVRPDMGRGELSVVPQVPEGSSPISGENIRLGDGSVAVSAERGRNTYRTTVEPDV
FT                   ALEELVVGHTLPRGAKVRSVRLNGERTRYRVEETNRGLEVLVEAGTEGEQELVVRTR"
     atggcaccgc cgctgttttc gcgccggctc gcgtgggggt tcttcaccgc gctggcgttg        60
     ctcttgccgg ccctgcccgc ctccgcgcag ggcgccccgg actcccccac gctctcggtg       120
     agcgagcgcc tcgaggagag gcgctacgtg acgacgggcg agcgggccta cgtcgtgggc       180
     accgaggacg ggcgcttccc ggcgatgggc ttccacaccc gcggcgagat gggcggcgtc       240
     tggagccccc cgataaagct cctcgacggc atctggttcg gcgtagacgg cgagtggctc       300
     cccccggcga cccgcttcac cagcggctac gggtacgtga ggatggagct gccgggccgc       360
     gaggggctcg ccgtcacccg caccgacttc gtccccgacg ggctccgcgc ggccctcttc       420
     ggcctcacct tcagcgccga gaccgagcag agcctcaccc tcaaggtgga cgcccactcc       480
     gagctcatgg gagcctaccc ctggggcgag accaccccga gccagaagac ctacaacctc       540
     gaggacagcg tctccgtcga gcacggcagg ctcgtcttcc gggagagggg gacgcccccg       600
     gccgagaacg ccctccccca cgactgggcg gcggtcgtcg gctcgagcct cgagccgagc       660
     ggcagcgaca cgggggagga cttccgcggc ccgcaggacc cgcccgtgat ctgccccgcc       720
     tccccggagg aggcccccga ccgctgcgac gacaccgcct acggcaaggg gaagggcggc       780
     cagctccgct acgagatcac cgtccccgcc ggggagacga ggaccgtgtg gttcgccgtc       840
     gcgggggcgg acttcgacgg cgaggcctcc gacggcgagg cccccgaaga cgcggtggcc       900
     gcggccatag aggagcacga ggcggcgctc gccgaccccg aggcgctgct cgaggagaag       960
     gtctccgggc ggctcgcgct ggcgcggtac acgagcctgg atctcccggg cgaccggcgg      1020
     ctggagcggg gcatagagtg gagcaagcag aacctcgccg actccgtgca ggccgcggaa      1080
     gacctggaga tccgggagac caacgccggg cagagctacc cggcccccga gggtgagctc      1140
     gaccgggcgc gcttcctcgg cgcaggcttc ccggactacc agtggctctt cgccaccgac      1200
     ggcgagtaca ccgccttcgc cagcgtcgcc gccgggcagt tcgagcccat aaaggaccac      1260
     ctgcgggcgc tccgggacgt gagcgagata gacaacggcg gcagcggcaa ggtcgtccac      1320
     gaggtcgtga ccgacggcag cgtctacttc ggatccaacg ccgaccccgg caacaccgac      1380
     gagaccgcca agttcccgag cgccgtcgcc ctcgtctggc gctggaccgg cgacgacgcc      1440
     ttccgcgacg agatgtacgg cttcgccagg cgcaacatgc actacatctt ccgcgagctc      1500
     gacgaggacg gcgacctctg gcccgagggc ctcggcaacg tcgagcgcga ggggatgggc      1560
     gaggagaagc tggataatgc cgtctacacc atccgcggcc tctacgacct cgccgacatg      1620
     gcccgcagca ggggcgacga agagaccgag aggtgggccg tgaagcgcac ccgcgcgatg      1680
     gagcggcgct tcgagcgggc ctggtggttc gggcgcgagg gggcgacgca gtacgccgac      1740
     tccctgagga acccgggcaa cgagcgggtc ttccagcggc actggatcgg ggcgaccccc      1800
     atggaggtcg agctcgtgga ccgcaggggc gagacggtgc cggggctcgc ctcccgcgag      1860
     cacggcctcg ccgccctgcg cgagcgcgag ctcgcctgct acaccgaccg cttcgggatg      1920
     taccacaccg ggaccggccc gaccgcggcc gggggcggca acccgggagc gagctgcgac      1980
     gagcacgtct ccgaggtgcc ctccgagcgc agcatcttca cgctcaacac cgccgtcatg      2040
     gcggtcggcg agggcaacta cggcaggctc ggcgaggacc agcagcggca ctacaccggc      2100
     gcaaacgccg ccctgcagct catccccgac gagcagcccg gggcgatgcc cgagatcgcc      2160
     ccctcccccg actacgggcg ctccatagac cggccgctca acgagcgggc gatggtgctg      2220
     caggcctggg gcgcctacgg cacgctctgg ccgatcgtcc accagtggct cggcgtccgc      2280
     ccggacatgg gccgcggcga gctctcggtc gtcccgcagg tccccgaggg ctcctccccc      2340
     atctccggcg agaacatccg gctcggcgac ggatcggtcg ccgtctccgc ggagcgaggc      2400
     aggaacacct accgcaccac cgtcgagccg gacgtggcgc tcgaggagct cgtcgtcggg      2460
     cacaccctcc cgcgcggcgc gaaggtccgc agcgtgaggc tcaacggcga gaggacccgc      2520
     tacagggtcg aggagaccaa ccgcgggctg gaggtgctcg tggaggcggg gaccgagggc      2580
     gagcaggagc tcgtcgtccg cacccggtag                                       2610
//

If you have problems or comments...

PBIL Back to PBIL home page