(data stored in ACNUC7421 zone)

EMBL: CP000386.PE31

CP000386.PE31        Location/Qualifiers
FT   CDS_pept        complement(33290..33895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0031"
FT                   /product="Redoxin"
FT                   /note="PFAM: Redoxin Thioredoxin domain; KEGG: sth:STH734
FT                   cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03012"
FT                   /db_xref="GOA:Q1B016"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B016"
FT                   /protein_id="ABG03012.1"
FT                   /translation="MARNTPSGGKKRGAGAPQANRPLVLALAGFTALAIVVIALLAVLS
FT                   ARGGDAGNFTPNDQGLLPVGSQAPDFTTKTVTGERVSLPEGQAAMLVFFATWCPHCQNE
FT                   APTIADFSREYEDLRVMMISVADENWPETDTPQEVRRFVSEYGIQGPAIYDPELGRTYR
FT                   VTGTPTVYVVDANGTIVGAHSGEAPREVYEGWIQEALG"
     atggcacgca acaccccctc cggcggcaag aagcggggag ccggggctcc ccaggccaac        60
     aggcccctcg tcctcgccct cgcgggcttc acggcgctgg ccatagtggt catagccctg       120
     ctggcggtgc tctcggcccg ggggggcgac gccgggaact tcacccccaa cgaccagggg       180
     ctgctcccgg tcggcagcca ggccccggac ttcaccacca agaccgtgac cggcgagcgg       240
     gtctcgctgc ccgaggggca ggccgccatg ctcgtcttct tcgccacctg gtgcccccac       300
     tgccagaacg aggccccgac catagccgac ttctccaggg agtacgagga tttgcgggtc       360
     atgatgatca gcgtggccga cgagaactgg cccgagaccg acaccccgca ggaggtgcgc       420
     cggttcgtca gcgagtacgg catccagggc ccggccatct acgacccgga gctgggccgg       480
     acctaccggg tgaccgggac cccgaccgtc tacgtcgtgg acgcgaacgg cacgatcgtc       540
     ggcgcgcact ccggcgaggc cccgagggag gtttacgagg gctggatcca ggaggccctc       600
     ggctag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page