(data stored in ACNUC7421 zone)

EMBL: CP000386.PE311

CP000386.PE311       Location/Qualifiers
FT   CDS_pept        336928..339096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0316"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: mag:amb3065 1,4-alpha-glucan branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: glycoside
FT                   hydrolase, family 13-like alpha amylase, catalytic region;
FT                   SMART: Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03292"
FT                   /db_xref="GOA:Q1AZ86"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZ86"
FT                   /protein_id="ABG03292.1"
FT                   /translation="MRREEAIRAVVAGDHPDPFSFLGPHEEAGRRVVRTFLPGAARVRV
FT                   LSAAGRPLGELERVHPEGFFSGPLSGNGRYRLRVLWEGGGEDELEDPYRFPPVLSDYDL
FT                   YLFGEGNNHRIYRHLGAHPAEMDGVCGTAFAVWAPNARRVSVVGDFNLWDGRRHPMRNR
FT                   NGVWEIFLPGVGPGALYKYEIKDAGGSLLPLKADPYGFFAEQYPGTASIVWDLSRHRWE
FT                   DGEWMERRGSRNAPDAPMAIYEVHLGSWRRRPDGSHLTYRELAEELVPYVAGLGYTHVE
FT                   LLPPMEHPFGGSWGYQPVGLFAPTSRFGPPEDFKHLVDAFHRAGVGVIADWVPAHFPED
FT                   AHGLARFDGTHLYEHADPRKGRHPDWGTLIYNYGRNEVRNFLISNALFWLDEYHIDGLR
FT                   VDAVASMLYLDYSRKEGEWVPNEHGGNENLEAIAFLRRMNEVVYGEAPGAFTVAEESTA
FT                   WPMVSRPTYMGGLGFGYKWNMGWMHDTLQYMKEDPVHRRYHHDRITFGLLYAFNENFIL
FT                   PLSHDEVVHGKGSLLGRMPGDRWQRFANLRAYYGFMYGHPGKQLLFMGGEFAQEREWDS
FT                   GSQLDWHLLEGGENRGVRDLVADLNALYRATPALHQVDFEPEGFEWVEGGDAEQSVVSF
FT                   LRRARNPEDFVLVVSNFTPVVRHGYRVGVPASGPYAEVLNTDDPRYGGSGVANGELEAE
FT                   EVPWHGRPFSLRLTLPPLATVFLRPRPV"
     gtgagacgcg aagaggccat ccgcgccgtg gtcgccggcg accaccccga ccccttctcc        60
     tttctggggc cgcacgagga ggcgggccgg cgggtggtga ggaccttcct gcccggcgcg       120
     gcgcgggtgc gggtgctctc cgccgccggc cggccgctgg gagagctgga gcgcgtccac       180
     ccggaggggt tcttctccgg ccccctctcc ggcaacggcc gctaccggct gcgggtcctc       240
     tgggagggcg ggggggagga cgagctcgag gacccctacc ggttcccgcc cgtcctcagc       300
     gactacgacc tctacctctt cggcgagggg aacaaccacc gcatctaccg gcacctcggg       360
     gcccacccgg cggagatgga cggcgtctgc ggcaccgcct tcgccgtctg ggcccccaac       420
     gcccgcaggg tctcggtcgt cggggacttc aacctctggg acggccggcg gcaccccatg       480
     cgcaaccgca acggggtgtg ggagatcttc ttgcccggcg tggggcccgg ggccctctac       540
     aagtacgaga taaaggacgc gggcggctcc ctgcttccgc tcaaggccga cccctacggc       600
     ttcttcgccg agcagtaccc gggcaccgcc tccatcgtct gggatctctc ccgccaccgg       660
     tgggaggacg gggagtggat ggagcggcgg gggagcagga acgccccgga tgcccccatg       720
     gccatctacg aggttcacct gggctcctgg cgccgccgcc cggacggctc ccacctcacc       780
     taccgcgagc tggccgagga gctcgtcccc tacgtcgccg ggctcggcta cacccacgtc       840
     gagctcctgc cgcccatgga gcaccccttc ggaggctcgt ggggctacca gcccgtgggg       900
     ctcttcgccc ccaccagccg cttcgggccg cccgaggact tcaagcacct ggtggacgcc       960
     ttccaccggg cgggcgtcgg ggtcatcgcg gactgggtcc cggcccactt ccccgaggac      1020
     gcccacggcc tcgcccgctt cgacggcacc cacctctacg agcacgccga cccccgcaag      1080
     gggcgccacc cggactgggg caccctcatc tacaactacg ggcgcaacga ggtgcgcaac      1140
     ttcctcatct ccaacgccct cttctggctc gacgagtacc acatcgacgg cctcagggtg      1200
     gacgccgtgg cctccatgct ctacctggac tactcccgga aggagggcga gtgggtcccc      1260
     aacgagcacg ggggcaacga gaacctggag gccatagcct ttctgcggcg gatgaacgag      1320
     gtggtctacg gggaggcgcc gggggccttc accgtcgccg aggagtccac cgcctggccg      1380
     atggtctccc ggcccaccta catggggggg ctgggcttcg gctacaagtg gaacatgggc      1440
     tggatgcacg acaccctgca gtacatgaag gaggaccccg tccaccgccg gtaccaccac      1500
     gacaggatca ccttcggcct cctctacgcc ttcaacgaga acttcatcct gccgctctcc      1560
     cacgacgagg tggtgcacgg caagggctcg ctcctgggga ggatgcccgg cgaccggtgg      1620
     cagcgcttcg ccaacctgcg cgcctactac ggcttcatgt acggccaccc cggcaagcag      1680
     ctgctcttca tgggcgggga gttcgcccag gagcgggagt gggacagcgg ctcccagctg      1740
     gactggcacc tgctggaggg gggcgaaaac cggggcgtgc gcgacctcgt cgccgacctc      1800
     aacgccctct accgcgccac ccccgccctg caccaggtgg acttcgagcc ggagggcttc      1860
     gagtgggtgg agggcggcga cgccgagcag agcgtggtct cttttctgcg ccgcgcccgc      1920
     aacccggagg acttcgtgct cgtggtctcc aacttcaccc cggtcgtccg gcacggctac      1980
     cgggtcgggg tgcccgcctc cggaccctac gccgaggtgc tcaacaccga cgacccccgc      2040
     tacggcggca gcggggtggc aaacggcgag ctcgaggccg aggaggtccc ctggcacggc      2100
     aggcccttct ccctccggct caccctcccg ccgctggcca ccgtcttcct gcgcccccgc      2160
     ccggtgtag                                                              2169
//

If you have problems or comments...

PBIL Back to PBIL home page