(data stored in ACNUC7421 zone)

EMBL: CP000386.PE321

CP000386.PE321       Location/Qualifiers
FT   CDS_pept        complement(349951..350916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0326"
FT                   /product="nucleoside recognition"
FT                   /note="PFAM: nucleoside recognition; KEGG: gka:GK3080
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03302"
FT                   /db_xref="GOA:Q1AZ76"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ76"
FT                   /protein_id="ABG03302.1"
FT                   /translation="MGAIKALRTISWAEGLRSGLRTTWELGLVIFPVTAAVALLRFTPV
FT                   YGLLLEALAPAMGLFGLPGEAAVPLVLGNLLGLYAAIGAILAMELTVKQVFTLALMLGF
FT                   SHMLPVETAICRRVGVSATLVVAFRLGLAAAAGLAVARLWDGGGERARYGLAAPVAEEP
FT                   SGWGEALLAALRAAAEGVAQLALIVFPVMLLIQALKDLGALDRFAALMRPLMRPLGIAP
FT                   RGAVTVAGGLVFGLAFGAGIILEQAREQRFSRREITLIALFLCACHAVIEDTLIFVPLG
FT                   IDVLPLLVIRLLSAIALVFLIARLWPEVERGEEHDERSPG"
     atgggggcga tcaaagcact gcgcacgatc tcctgggcgg agggcctcag gagcggcctg        60
     aggacgacct gggagctcgg gctcgtgatc ttcccggtca ccgccgcggt cgccctcctg       120
     cgcttcaccc cggtctacgg cctgctcctg gaggcgctcg ccccggccat ggggctcttc       180
     gggctgccgg gggaggccgc ggtcccgctg gtgctcggca acctgctggg cctctacgcc       240
     gccataggcg ccatcctggc gatggagctc acggtgaagc aggtgttcac cctggcgctc       300
     atgctcggct tctcgcacat gctcccggtg gagaccgcca tctgccgccg ggtgggggtg       360
     agcgcgacgc tggtggtggc gttccggctg gggctcgcgg cggccgccgg gctcgccgtg       420
     gcccggctgt gggacggcgg cggggagagg gcccgctacg ggctggccgc ccccgtcgcg       480
     gaggagccct cggggtgggg cgaggcgctt ctcgcggcgc tgcgcgccgc ggcggagggg       540
     gtggcgcagc tcgccctcat cgtcttcccc gtcatgctgc tcatccaggc cctcaaggac       600
     ctcggcgccc tcgaccgctt cgcggcgctc atgcggcccc tcatgcgccc gctcggcatc       660
     gccccccgcg gggccgtcac cgtggcgggc gggctggtct tcgggctcgc cttcggggcc       720
     gggatcatcc tggagcaggc ccgcgagcag cgcttcagcc ggcgggagat caccctgata       780
     gccctgttct tgtgcgcctg ccacgcggtc atcgaggaca ccctgatctt cgtgccgctc       840
     gggatcgacg tgctgccgct gctggtcatc cggctgctct cggctatcgc gctggtcttc       900
     ctgatcgccc gcctgtggcc ggaggtagag agaggggagg aacacgatga gcgaagcccg       960
     ggatga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page