(data stored in ACNUC7421 zone)

EMBL: CP000386.PE322

CP000386.PE322       Location/Qualifiers
FT   CDS_pept        complement(350965..353022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0327"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: chy:CHY_1100 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM:
FT                   helix-hairpin-helix motif BRCT NAD-dependent DNA ligase
FT                   zinc-finger, NAD-dependent DNA ligase C4-type NAD-dependent
FT                   DNA ligase, OB-fold; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03303"
FT                   /db_xref="GOA:Q1AZ75"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZ75"
FT                   /protein_id="ABG03303.1"
FT                   /translation="MGAPTLPRIIPPVAEKLAEARQRVEELREQIRYHNRKYYVEDAPE
FT                   ISDAEYDALYRELEELESRFPELVTPDSPTQRVGGEPLEEFEEVRHAVPMLSLQNARRV
FT                   EELREWDARVRRLLGPEEEGRLRYVTELKIDGLAVSLRYENGRLVRGATRGNGFVGEDV
FT                   TRQLRTIRSVPDRLDDDPPGVLEPRGEVYIKLKDFEEFNRRRQERGERPFANPRNLAAG
FT                   SVRQLDPRVTARRPLTIYLYGVGEGYENFESHSEALAALRRYGLRVNPHTVHGDIDSVI
FT                   EECGRWAKKREALDFQVDGVVVKVDSREQQERLGAVQKAPRWAIAYKFEPLAGRTRLRD
FT                   IVVTVGRTGALTPQAVLEPVNVGGVTISRATLHNEDYIKEKGILIGDTVIVERAGDVIP
FT                   QVVRPVPEERDGDEEEFRMPERCPVCGERVSRPEGEAITRCANVRCPAQALEHIIHWAS
FT                   RGAMDIEGLGEKLARKLFDLGLIRDVADLYELRAEQLAPLEGLGEKSAQNLIRAIERSK
FT                   ERPFDRVLFGLGIRHVGSATAELIAERFSGEELLRGVGVEELTQIEGVGEIVARAVVEY
FT                   FSLEENRKLVRRLMEHGLNFGPVRGKPEEGPLSGRRLVITGTLSRPRSEISDLIEGAGG
FT                   TVTSSVSRNTDYLVAGENPGSKLERARELGVPVLDEEGLRRLLSGEERPG"
     ttgggagccc ccaccctccc gcgtataatc ccccccgtgg ccgagaagct cgccgaggca        60
     agacagcggg tagaggagct gcgcgagcag atccgctacc acaaccgcaa gtactacgtc       120
     gaggacgcgc cggagatctc cgacgccgag tacgacgccc tctaccggga gctggaggag       180
     ctcgagagcc gcttcccgga gctcgtcacc cccgactccc ccacccagcg ggtcggcggg       240
     gagccgctgg aggagttcga ggaggtccgg cacgccgtcc ccatgctctc cctgcagaac       300
     gcccgcaggg tcgaggagct ccgggagtgg gacgcgcgcg tccggcgcct gctcggcccg       360
     gaggaggagg ggcggctgcg ctacgtgacc gagctcaaga tagacgggct ggccgtctcg       420
     ctgcgctacg agaacgggcg cctcgtccgg ggcgcgaccc ggggcaacgg ctttgtcggg       480
     gaggacgtga cccggcagct gcgcaccatc cgctccgtcc ccgaccggct cgacgacgac       540
     cccccggggg tgctggagcc ccggggcgag gtgtacataa agctcaagga cttcgaggag       600
     ttcaaccggc ggcgtcagga gcggggcgag cggcccttcg ccaacccccg caacctggcg       660
     gcgggctccg tgcggcagct ggaccccagg gtcaccgccc ggcgccccct caccatctac       720
     ctctacggcg tgggggaggg ctacgagaac ttcgagagcc actccgaggc gctcgccgcg       780
     ctcaggcgct acgggctccg ggtaaacccc cacaccgtgc acggggacat agactcggtg       840
     atagaggagt gcgggcggtg ggccaagaag cgggaggcgc tggacttcca ggtggacggg       900
     gtcgtcgtca aggtggactc ccgcgagcag caggagaggc tcggcgcggt gcagaaggcc       960
     ccccggtggg ccatagcgta caagttcgag ccgctcgccg ggcgcacccg gctcagggac      1020
     atcgtggtga ccgtcggcag gaccggggcc ctgaccccgc aggcggtgct cgagccggtg      1080
     aacgtgggcg gggtcaccat ctcgcgcgcc accctgcaca acgaggacta cataaaggag      1140
     aagggcatcc tcatcggcga cacggtcatc gtggagcggg cgggggatgt gatcccgcag      1200
     gtcgtgaggc ccgtccccga ggagcgggac ggcgacgagg aggagttccg gatgccggag      1260
     cggtgcccgg tctgcgggga gagggtctcc cggcccgagg gggaggccat cacccgctgc      1320
     gcgaacgtcc gctgcccggc gcaggcgctg gagcacatca tccactgggc gagccgcggg      1380
     gccatggaca tcgaggggct gggcgagaag ctcgcgagga agctcttcga cctcggcctc      1440
     ataagggacg tggcggacct ctacgagctg cgggccgagc agctcgcccc cctggagggc      1500
     ctcggcgaga agagcgcgca gaacctgatc cgggcgatag agcggagcaa ggagcggccc      1560
     ttcgaccggg tgctgttcgg gctggggatc cggcacgtcg gctcggcgac ggcggagctg      1620
     atcgccgagc ggttctccgg ggaggagctg ctgcgcggcg tgggcgtcga ggagctcacg      1680
     cagatagagg gcgtcgggga gatcgtcgcc cgcgcggtgg tggagtactt ctcgctggag      1740
     gagaaccgga agctggtccg ccgcctgatg gagcacggcc tgaacttcgg cccggtgcgc      1800
     ggcaagccgg aggagggccc gctctccggc aggcggctgg tcataaccgg caccctctcc      1860
     cggccccgga gcgagatctc cgacctcata gagggggcgg gcgggacggt gacctcctcg      1920
     gtgagccgca acacggacta cctcgtcgcg ggcgagaacc cgggctcgaa gctggagcgg      1980
     gcccgcgagc tgggcgtccc ggtgctcgac gaggagggcc tgaggcggct gctctccggc      2040
     gaggagcggc ccggctag                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page