(data stored in ACNUC7421 zone)

EMBL: CP000386.PE33

CP000386.PE33        Location/Qualifiers
FT   CDS_pept        complement(34412..35284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0033"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hma:rrnAC2881
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03014"
FT                   /db_xref="GOA:Q1B014"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B014"
FT                   /protein_id="ABG03014.1"
FT                   /translation="MSVRELHLRAGGVGVRCLAAGEGEPAAVLLHGASLDCADLSFGHL
FT                   IGPLSGRRRVYAPDWPGYGGSERPPEAAYDLAYYERFLERLLDALGLERADLVGLSLGG
FT                   GVALSLALREPRRVRRLVLAGSYGLGRRVPWGPLGAALGRSALAARLAYGLMRRSRPAL
FT                   RLGLRNVVCDPAAVTEELLEELARQAALPGAGRAFLAFRRSEVGWRGLRSDLSGDLHRL
FT                   AVPTLLVHGSRDRIVPAGWAVEAHRRIPRSELLILEGCGHWVPRERPEEFSRAVERFLS
FT                   RPDPAGRPR"
     gtgtccgtcc gggagctgca cctgcgggcg ggcggggttg gggtccgctg tctggcggcc        60
     ggggaggggg agcccgccgc ggtgctgctg cacggggcga gcctggactg cgccgacctc       120
     tccttcgggc acctcatcgg gccgctctcg gggcgccgcc gggtctacgc ccccgactgg       180
     ccgggctacg gcgggagcga gcgcccgccg gaggcggcct acgacctggc ctactacgag       240
     aggtttctgg agcggctgct ggacgccctg ggcctcgagc gcgccgacct cgtgggcctc       300
     tccctcggcg ggggggtagc cctctccctg gcgctgcgcg agccccgccg ggtgcggcgg       360
     ctggtgctcg cggggagcta cggcctggga cgccgggtgc cctgggggcc gctcggcgcg       420
     gcgctcgggc gctcggcgct ggcggcgcgc ctggcctacg gcctcatgcg ccgcagccgc       480
     cccgccctcc ggctcgggct gcgcaacgtg gtctgcgacc cggcggcggt gacggaggag       540
     ctcctggagg agctggcccg ccaggccgcc ctccccggcg cggggagggc ctttctcgcc       600
     ttccgccgaa gcgaggtggg ctggaggggg ctgaggtccg acctctccgg cgacctccac       660
     cggctcgcgg tcccgacgct cctcgtgcac ggctcccgcg acagaatcgt accggcgggc       720
     tgggcggtcg aggcgcaccg gcgcatcccg cgctccgagc tcctcatcct cgagggctgc       780
     gggcactggg tgcccaggga gcggccggag gagttcagcc gggcggtcga gaggtttctg       840
     tcgcggcccg acccagcagg gcgtccacgc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page