(data stored in ACNUC7421 zone)

EMBL: CP000386.PE336

CP000386.PE336       Location/Qualifiers
FT   CDS_pept        362408..366877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0341"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="PFAM: glutamine amidotransferase, class-II glutamate
FT                   synthase, alpha subunit-like ferredoxin-dependent glutamate
FT                   synthase glutamate synthase; KEGG: mca:MCA2039 glutamate
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03317"
FT                   /db_xref="GOA:Q1AZ61"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ61"
FT                   /protein_id="ABG03317.1"
FT                   /translation="MTLKTGLYDPAYEHDACGFGFVARVDGRKTRETVEEGLEILRNLE
FT                   HRGARGSDPETGDGAGILLQLPDAFFRREAGRLGIELPPPGHYAVGTLFESEEGLGAER
FT                   MLEEIAAEEGQRVLGFRDVPVDAERCGRLARRVMPRIRQFFVGREAPDEMAFERKLYVI
FT                   RRRLHKAVADTHACYVVTLSSRTIVYKGLLTGVQLPEFYLDLQDPAVQSAIALVHARFS
FT                   TNTLGSWELAHPYRYVAHNGEINTLRGNINWMRARESRLESELFGEDLGKISPVIQPGG
FT                   SDSAAFDNVLELLYLAGRSLPHAVAMMVPEAWENDELMDPERRAFYRYHSALMEPWDGP
FT                   AAVAFTDGRLIGATLDRNGLRPARYSVTKDGRVIMASEDGALRVPAEEVVERWRLQPGR
FT                   MLVVDTERHEILHDEDVKRPLFRRRPYARWLEEQEIHLDELPDVEPDPRPEPATLFERQ
FT                   RAFGYTVEDLRLLLTPMARGGKEPDGSMGTDTPLAVLSERPQLLFNYFKQHFAQVTNPP
FT                   IDPLREELVMSLKMSLGPEQNLFDETPRHCRRVLLDHPILTGPELEKVRHLGREPFSAT
FT                   TLSALFPAAGGGEGLRRALESLCERAERAVRGGSPVLVLSDRGVSHNQAPIPSLLATAA
FT                   VHHHLVRRGIRTATTLVVETAEAREVHHFALLVGYGATAVSPYLAFETIEKLARDGMLG
FT                   GVGPEEAQENYIKAVQKGLLKILSKMGISTLLSYCGAQIFEAVGLSREVIDRYFTGTAS
FT                   RIGGVGLEEIAREVLMRHEAAFRAGELGPEELDVGGEYQQRQQGQYHQWNPETIVPLQR
FT                   AVRTRSFETFKEFTRHFDERSARFATLRGLLEFEEDPIPLEEVEPAREIVRRFTTGAMS
FT                   LGALSKEAHETLAVAMNRIGGKSNTGEGGEDPERFGDERRSAIKQVASGRFGVTTEYLV
FT                   NADMLQIKMAQGSKPGEGGQLPGHKVSGYIAKIRYSTPGVGLISPPPHHDIYSIEDLAQ
FT                   LIHDLKNANPRALVSVKLVAEAGVGTIAAGVAKAKADHITISGHDGGTGASPLSSIKHA
FT                   GLPWELGLAETQQVLVQNDLRGRVVLETDGQLKTGRDVVVAALLGAEEFAFSTAPLVTV
FT                   GCIMMRVCHLNTCPVGVATQDPVLRKKFAGAPEHVINYFFFLAEEVREYMARMGFRTFE
FT                   EMVGRCDRLRPRAALDHWKARGVDLSPLLHRPQIPQGVAIRHVQQQNHNLEKALDNELI
FT                   RRCRPALEGGEPVRFSRLILNTNRTVGGMLSGEVARRYGQEGLPDGTIRIDFKGVAGQS
FT                   FGAWLAKGITFTLEGTTNDYAGKGLSGGRLAVFPSREAAYRPEEAIVVGNVALYGATGG
FT                   EAYFRGFAGERFCVRNSGARAVVEGVGDHGCEYMTGGVVVVLGPTGRNFAAGMSGGMAF
FT                   VLDEESRFEKLCNTDMVGLEAVESEEDVALLRGMVEAHLRWTSSAVARRVLEEWEALLP
FT                   KFVKVMPHDLRRVLEERRRAEEEVEVAG"
     ttgaccctca aaaccggcct ttacgatccc gcatacgagc acgacgcctg cggcttcggg        60
     tttgtagccc gggtggacgg gaggaagacc cgggagacgg tggaggaggg gctggagatc       120
     ctgcgcaacc tcgagcaccg gggtgcccgg gggagcgacc cggagactgg ggacggcgcg       180
     gggatacttc tgcagctgcc ggacgccttc ttccgccggg aggcggggag gctcgggata       240
     gagcttccgc cgcccggcca ctacgccgtc ggcaccctct tcgagtccga ggaggggctc       300
     ggggccgagc ggatgctgga ggagatcgcc gccgaggagg gccagcgggt gctgggtttc       360
     cgggacgtgc cggtggacgc ggagcgctgc gggaggctcg cccgcagggt catgccgcgc       420
     atccggcagt tcttcgtggg gcgggaggcg ccggacgaga tggccttcga gcgcaagctc       480
     tacgtcatcc ggcggcggct gcacaaggcc gtggcggata cccacgcctg ctacgtggtg       540
     accctctcct cccgcaccat cgtgtacaag ggcctgctca ccggggtgca gctgcccgag       600
     ttctacctcg acctgcagga cccggcggtg cagagcgcca tcgcgctcgt ccacgcccgg       660
     ttctccacca acacgctggg gagctgggag ctcgcccacc cctaccgcta cgtggcccac       720
     aacggcgaga taaacaccct caggggcaac atcaactgga tgcgggcccg ggagagccgg       780
     ctggagtcgg agctcttcgg ggaggatctg gggaagatct cgcccgtcat ccagcccggc       840
     ggcagcgact cggccgcctt cgacaacgtg ctggagctgc tgtacctggc ggggcgctcg       900
     ctgccgcacg cggtggcgat gatggtgccc gaggcgtggg agaacgacga gctcatggac       960
     cccgagcgcc gggccttcta ccgctaccac agcgccctca tggagccgtg ggacggcccg      1020
     gcggcggtcg ccttcaccga cgggcggctc atcggggcca cgctcgaccg caacggcctc      1080
     cggcccgccc gctactccgt caccaaggac gggcgcgtga tcatggcctc cgaggacggg      1140
     gcgctgcgcg tcccggcgga ggaggtcgtc gagcgctggc ggctgcagcc gggcaggatg      1200
     ctcgtggtgg acaccgagcg gcacgagatc ctgcacgacg aggacgtcaa gcggccgctc      1260
     ttccggcgcc ggccctacgc gcggtggctc gaggagcagg agatccacct cgacgagctg      1320
     cccgacgtgg agcccgaccc gcgccccgag cccgccaccc tcttcgagcg gcagcgggcc      1380
     ttcgggtaca cggtggagga cctgcggctc ctgctcaccc cgatggcccg cggcggcaag      1440
     gagcccgacg gctcgatggg caccgacacc cccctcgccg tgctctccga gcggccgcag      1500
     ctgctcttca actacttcaa gcagcacttc gcgcaggtca ccaacccgcc catagacccg      1560
     ctccgggagg agctggtgat gtcgctcaag atgtcgctgg ggcccgagca gaacctcttc      1620
     gacgagacgc cgaggcactg ccggcgggtg ctcctggacc accccatcct caccgggccg      1680
     gagctggaga aggtccggca cctgggcagg gagcccttct ccgccaccac cctctccgcc      1740
     ctcttccccg ccgccggcgg cggggagggg ctgcggcggg cgctggagag cctctgcgag      1800
     cgggccgagc gggcggtgcg cggcggttcg ccggtgctgg tgctcagcga ccggggggtg      1860
     agccacaacc aggcccccat ccccagcctg ctggccaccg cggcggtgca ccaccacctg      1920
     gtccggcgcg gcatccggac cgccaccacc ctggtggtgg agaccgccga ggcgcgggag      1980
     gtgcaccact tcgcgctgct ggtgggctac ggggcgaccg ccgtgagccc gtatctggcc      2040
     ttcgagacca tagagaagct cgcccgcgac gggatgctcg gcggggtggg ccccgaggag      2100
     gcccaggaga actacataaa ggccgtccag aaggggctgc tgaagatcct ctccaagatg      2160
     ggcatctcca ccctgctctc gtactgcggg gcccagatct tcgaggccgt cggcctcagc      2220
     cgggaggtca tagaccgcta cttcaccggc accgcctccc gcatcggcgg ggtggggctc      2280
     gaggagatcg cccgcgaggt cctgatgcgg cacgaggccg ccttccgcgc cggggagctc      2340
     ggccccgagg agctcgacgt cgggggggag taccagcagc ggcagcaggg gcagtaccac      2400
     cagtggaacc ccgagaccat cgttcctttg cagcgggcgg tccgcacccg cagcttcgag      2460
     accttcaagg agttcacccg ccacttcgac gagcggagcg cgcgcttcgc cacgctgcgc      2520
     gggctcctgg agttcgagga ggaccccata ccgctggagg aggtggagcc cgcgcgggag      2580
     atcgtccggc gcttcaccac cggggcgatg tccctcgggg cgctgagcaa ggaggcccac      2640
     gagacgctcg ccgtcgccat gaaccgcatc ggcggcaagt ccaacaccgg cgagggcggt      2700
     gaggacccgg agcgcttcgg cgacgagcgg cgcagcgcca taaagcaggt cgccagcggc      2760
     cgcttcgggg ttaccaccga gtacctggtc aacgccgaca tgctccagat aaagatggcc      2820
     cagggctcca agcccggcga gggcggccag ctgcccgggc acaaggtcag cgggtacatc      2880
     gccaagatcc gctactccac ccccggggtg gggctcatct ccccgccgcc ccaccacgac      2940
     atctactcca tcgaggatct cgcccagctc atccacgacc tcaagaacgc caacccccgc      3000
     gcgctggtga gcgtcaagct cgtcgccgag gccggggtgg gcaccatcgc cgccggggtg      3060
     gccaaggcga aggccgacca cataaccatc tccggccacg acggggggac cggcgcctcg      3120
     ccgctctcct ccataaagca cgccgggctg ccctgggagc tcgggctcgc cgagacccag      3180
     caggtgctcg tgcagaacga cctgcggggg cgcgtggtcc tggagaccga cggccagctc      3240
     aagaccggcc gcgacgtggt cgtggcggcg ctgctcggcg ccgaggagtt cgccttctcc      3300
     accgcgccgc tggtgacggt ggggtgcatc atgatgcggg tgtgccacct gaacacctgc      3360
     ccggtggggg tcgcgaccca ggacccggtg ctcaggaaga agttcgccgg cgcccccgag      3420
     cacgtcatca actacttctt cttcctggcc gaggaggtgc gggagtacat ggcgaggatg      3480
     ggcttccgca ccttcgagga gatggtcggc cgctgcgacc ggctgcggcc cagagcggcc      3540
     ctcgaccact ggaaagcgag gggcgtggac ctctcgccgc tcctgcaccg gccgcagata      3600
     ccgcagggcg tggccatcag gcacgtccag cagcagaacc acaacctgga gaaggcgctg      3660
     gacaacgagc tgatccgtcg gtgccgcccc gcgctggagg gcggggagcc ggtgcggttc      3720
     tcgcgcctga tcctgaacac caaccgcacc gtcgggggga tgctctccgg ggaggtcgcc      3780
     cgccgctacg ggcaggaggg gctccccgac ggcaccatcc gcatagactt caagggggtc      3840
     gccgggcagt ccttcggcgc ctggctcgcg aaggggatca ccttcaccct cgaggggacc      3900
     accaacgact acgcgggcaa ggggctctcc ggggggaggc tcgccgtctt cccctcccgc      3960
     gaggccgcct accggcccga ggaggccatc gtcgtcggga acgtcgccct ctacggggcc      4020
     accggcggcg aggcctactt ccgcggtttc gccggcgagc gattctgcgt gcgcaactcc      4080
     ggcgcgcgcg ctgtcgtcga gggcgtcggc gaccacggct gcgagtacat gaccggcggc      4140
     gtggtggtgg tgctcggccc caccgggcgc aacttcgccg ccgggatgag cggcgggatg      4200
     gccttcgtgc tggacgagga gagccgcttc gagaagctgt gcaacaccga catggtcggc      4260
     ctcgaggcgg tggagtccga ggaggacgtc gcgctgctga gggggatggt ggaggcccac      4320
     ctgcgctgga cgagcagcgc ggtggcgcgc cgggtgctcg aggagtggga ggcgttgctg      4380
     ccgaagttcg tgaaggtcat gccccacgac ctcaggcggg tgctggagga gcgccggcgg      4440
     gcggaggaag aggtggaggt ggccggctga                                       4470
//

If you have problems or comments...

PBIL Back to PBIL home page