(data stored in ACNUC7421 zone)

EMBL: CP000386.PE337

CP000386.PE337       Location/Qualifiers
FT   CDS_pept        366877..368304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0342"
FT                   /product="glutamate synthase (NADH) small subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="TIGRFAM: glutamate synthases, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mpa:MAP0173 glutamate synthase
FT                   (NADPH) small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03318"
FT                   /db_xref="GOA:Q1AZ60"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ60"
FT                   /protein_id="ABG03318.1"
FT                   /translation="MGDPKGFLKIGRKPVPKRPVEERVRDYRWVYEPMPEGELRRQASR
FT                   CMDCGVPFCNTGCPLANLIPDWNDLVYRDHWREAIDRLHATNNFPEFTGILCPAPCEAA
FT                   CVLSINDRPVTIKEIERSIIERAFEEGWVVPKPPPPERRTGKRVAVVGSGPAGLAAAQQ
FT                   LNRAGHSVVVFEKDDRPGGLLRYGIPDFKMEKWVIDRRLRQLEEEGIEFRTGAYVGYDP
FT                   TAEELRRGFDAVVLAVGALQGRDLPVPGRELRGIHLAMEYLVQQNRRVAGLPVEGEEIT
FT                   ARGKHVIILGGGDTSADCLGNVHREGCASVRVLTHGPKPPESPDPLEWPDWPFVLHTYP
FT                   AHEEGGERGWNVAVTGFSGEGGRVRRMHCVRTRRDPDGRTHHLPGTEFELEADLVLLAI
FT                   GFTGPVRDRLLEELGVEFGPRGAIATREGFDTGIPGVFVAGDARRGADLIVTAIAEGRK
FT                   AARQVDAYLMGRSLLPG"
     atgggcgacc cgaagggctt tctcaagata ggccgcaagc cggtccccaa gcgcccggtg        60
     gaggagcgcg tccgggacta ccgttgggtc tacgagccca tgcccgaggg cgagctgcgg       120
     aggcaggcct cccgctgcat ggactgcggg gtgcccttct gcaacaccgg ctgtcccctg       180
     gcgaatctca tccccgactg gaacgacctc gtctaccgcg accactggcg cgaggccata       240
     gaccggctgc acgccacgaa caacttcccc gagttcaccg gcatcctctg cccggcgccg       300
     tgcgaggcgg cgtgcgtgct ctccataaac gacaggccgg tcaccataaa ggagatagag       360
     cgctcgatca tcgagcgggc cttcgaggag gggtgggtcg tccccaagcc cccgccgccg       420
     gagaggcgga ccgggaagag ggtcgcggtg gtcgggagcg gcccggcggg gctcgccgcg       480
     gcgcagcagc tcaaccgggc cggccactcg gtcgtggtct tcgagaagga cgaccgcccc       540
     ggcggtctgc tgcgctacgg catcccggac ttcaagatgg agaagtgggt catagaccgc       600
     aggctgcgcc agctggagga ggaggggata gagttccgca ccggcgccta cgtggggtac       660
     gacccgacgg cggaggagct gcggcgcggc ttcgacgcgg tggtgctggc ggtgggggcg       720
     ctgcagggcc gggacctccc ggtgccgggg cgcgagctcc gcgggataca cctggccatg       780
     gagtacctgg tgcagcagaa ccggcgggtg gcgggcctcc cggtggaggg ggaggagatc       840
     accgccaggg gcaagcacgt gatcatcctg ggcggcgggg ataccagcgc cgactgcctg       900
     ggcaacgtcc accgcgaggg gtgcgcctcg gtgagggtgc tcacccacgg ccccaagccg       960
     cccgagagcc ccgacccttt ggagtggccc gactggccct tcgtgctgca cacctacccc      1020
     gcccacgagg agggcggcga gcgcggctgg aacgtcgctg tcaccggctt ctccggggag      1080
     ggcgggcgcg tgaggcggat gcactgcgtc aggacccggc gcgaccccga cggccggacc      1140
     caccacctcc ccggcacgga gttcgagctg gaggcggacc tggtgctgct cgccatcggg      1200
     ttcaccgggc cggtgcggga ccggctgctg gaggagctgg gggtggagtt cgggccgcgc      1260
     ggggcgatcg ccacgcggga gggcttcgac accggcatcc ccggcgtctt cgtggcgggg      1320
     gacgcccgcc ggggggccga cctgatcgtg accgccatcg ccgagggccg caaggccgcc      1380
     cggcaggtgg acgcctacct catgggccgc agcctgctgc ccggctga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page