(data stored in ACNUC7421 zone)

EMBL: CP000386.PE338

CP000386.PE338       Location/Qualifiers
FT   CDS_pept        complement(368305..370032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0343"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: dra:DR1078 antibiotic biosynthesis protein
FT                   LmbJ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03319"
FT                   /db_xref="GOA:Q1AZ59"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ59"
FT                   /protein_id="ABG03319.1"
FT                   /translation="MPIQDPHLPPPGLVVHADWSLHPAKRWMAAAVLRDGRYSVLAPEP
FT                   VGEPSTFLERMRERAAPGAGVFAGFDFPIGLPARYARLAGIDEFLPLLPRLGEGEWSGF
FT                   YEVAERPEQVSARRPFYPRRPGGAALRHLLDALGLGSADELLRECERGYPGRPPASPLF
FT                   WTIGPGQVGKAAISGWRDLLAPALRGSGPDVAVWPFDGALRELLRSREITVAETYPAEF
FT                   YRRLGLKPGSKRNREDRRANAPILKEWAGRLGARLTPQMSAAVEDGFGPGASGEDPFDA
FT                   AVGLLGMLAVALGHLPPGDPPDPQVRRVEGWILGSPPREGAREASAPPAEYDPLADLYD
FT                   REYAHDHDVPFWLALAGREGGPVVEWGAGTGRIAVPLAGAGHDVAAVELSEAMAARGRK
FT                   KGGAVQWVVGDMRGARLGRAFRLAVCAFNSFLCLLSVEDALAFLRNAREHLVPGGLLGV
FT                   EVSAFAPEELADPPGGATLRHDLTRKTPEGRLERFSVSRYDAASQLLEMRLFYELYGES
FT                   GELESRRAHDLTIRVTGRDELLLMLRLAGFEVEAVYGGFEGEPFTAASDHLIVLARRS"
     atgcccatac aagatcccca cctccccccg ccgggcctgg tcgtgcacgc cgactggagc        60
     ctgcacccgg ccaagcggtg gatggccgcc gccgtccttc gggacggccg gtactcggtg       120
     ctcgcgccgg agcccgtggg ggagccctcg accttcttgg agaggatgcg cgagcgcgcc       180
     gccccgggcg ccggggtgtt cgccggcttc gacttcccca tagggctccc ggcccgctac       240
     gcgcggctcg cgggcataga cgagttcctc cctctcctcc cgaggctggg agagggcgag       300
     tggtcgggat tctacgaggt cgccgagcgg ccggaacagg tctccgcgcg cagacccttc       360
     tacccgcgcc gcccgggcgg ggccgcgctg cgccacctcc tcgacgccct cgggctgggg       420
     tcggcggacg agctgctgcg cgagtgcgag cggggttacc cgggccgccc gcccgcatcg       480
     cccctcttct ggacgatcgg gcccgggcag gtgggcaagg ccgccatctc cggctggaga       540
     gacctcctcg cccccgccct gcggggctcc ggccccgacg tcgcggtctg gcccttcgac       600
     ggggcgctgc gcgagctctt gcgctcccgg gagatcaccg tggccgagac ctacccggcc       660
     gagttctacc ggcgcctggg cctgaagccc ggctccaaac ggaaccggga ggacaggcgg       720
     gcgaacgccc ccatcctgaa agagtgggcc gggaggctcg gcgcgcgcct caccccgcag       780
     atgagcgccg ccgtggagga cggcttcggc cccggcgcga gcggcgagga ccccttcgac       840
     gccgccgtcg gcctcctcgg catgctggcc gtggcgctcg ggcacctccc gccgggcgac       900
     ccgccggacc cgcaggtccg gcgggtcgag ggctggatcc tcggcagccc cccgcgcgag       960
     ggcgcacgcg aagcctccgc cccacccgcc gagtacgacc ccctcgccga cctctacgac      1020
     cgcgagtacg cgcacgacca cgacgtgccc ttctggctag ccctcgccgg gcgcgagggc      1080
     ggtcccgtcg tcgagtgggg cgccgggacc ggccgcatcg ccgtcccgct cgccggggcc      1140
     ggccacgacg tcgccgccgt cgagctctcg gaggcgatgg ccgcgcgggg ccggaagaaa      1200
     ggcggcgccg tccagtgggt cgtcggcgac atgcgcggcg cgaggctcgg gcgcgccttc      1260
     cggctcgcgg tctgcgcctt caactcgttt ctgtgcctgc tctcggtgga ggacgcgctg      1320
     gccttcctgc gcaacgcccg cgagcacctc gtccccggcg gcctgctcgg cgtcgaggtc      1380
     tcggccttcg cgccggagga gctcgccgac ccgcccggcg gggccacgct gcgccacgac      1440
     ctcacccgca agacgccgga gggcaggctg gagcgcttca gcgtctcccg ctacgacgcc      1500
     gcttcgcaac ttctggagat gcgcctcttc tacgagctgt acggcgagtc gggagagctg      1560
     gagagccgga gggcgcacga cctgaccatc cgcgtcaccg gccgggacga gctgctcctc      1620
     atgctgcgcc tcgcgggctt cgaggtcgag gccgtctacg gcggcttcga gggcgagccg      1680
     ttcacggcgg cgagcgacca cctcatcgtg ctcgcgagga ggagctag                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page