(data stored in ACNUC7421 zone)

EMBL: CP000386.PE344

CP000386.PE344       Location/Qualifiers
FT   CDS_pept        374792..375784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0349"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region
FT                   Transketolase-like; KEGG: sso:SSO1526 pyruvate
FT                   dehydrogenase E1 component, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03325"
FT                   /db_xref="GOA:Q1AZ53"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ53"
FT                   /protein_id="ABG03325.1"
FT                   /translation="MPGTISYTEALREALDEELGRDERTFFMGEDVGAFGGIFGEAAGL
FT                   QQKYGKERVFDTPISETFIVGGGVGAAITGLRPIVELQFADFVSVAMDEIYNKAAKWRY
FT                   MHGGLFKVPLVIIAPEGAMGGAGPEHSQCPEALFWSAAGLYVLTPATPADAKGLLKSAI
FT                   RDDNPVLFLPHKALGNTTGEVPEGEHLVPLGEAVVRRQGGDVTLVAWSAMVLKALEAAD
FT                   RLAEEGIEVEVIDPRGIRPFDFETVLRSVEKTGRVVLAHEAPLPGGPGSEVAAVIAERA
FT                   IASLEAPVRRVGAPDVPVPQSAHLERFVVPQTEDIVNAVREVAGSAVTV"
     atgccaggga ccatcagcta caccgaggct ctcagggagg cgctcgacga ggagctgggg        60
     cgcgacgaga ggaccttctt catgggagag gacgtggggg ccttcggcgg catcttcggg       120
     gaggccgcgg ggctccagca gaagtacggc aaggagcgcg tcttcgacac ccccatctcc       180
     gagacgttca tagtcggcgg cggggtcggt gcggccatca ccgggctccg gcccatcgtg       240
     gagctgcagt tcgccgactt cgtgagcgtg gcgatggacg agatctacaa caaggccgcc       300
     aagtggcgtt acatgcacgg cggcctgttc aaggtgccgc tggtgatcat cgcccccgaa       360
     ggggcgatgg ggggtgcggg ccccgagcac tcgcagtgcc cggaggcgct cttctggtca       420
     gccgcgggcc tgtatgtcct caccccggcc accccggcgg acgcgaaggg cctgctgaag       480
     agcgcgatcc gcgacgacaa cccggtgctc ttcctgccgc acaaggcgct cgggaacacc       540
     acgggcgagg taccggaagg ggagcatctc gtcccgctcg gcgaggccgt cgtgaggcgt       600
     cagggcggcg acgtgaccct ggtggcctgg tcggccatgg tcctcaaggc gctggaggct       660
     gcggatcggc tggcggagga gggcattgag gtcgaggtca tcgacccgcg ggggatccgg       720
     cccttcgact tcgagacggt gctgcggtcg gtcgagaaga ccggccgggt ggtgctcgcc       780
     catgaggctc cgctgcccgg ggggcccggc agcgaggtcg ccgcggtcat cgccgagcgg       840
     gccatagcct ccctggaggc accggtgagg cgggtcggtg cccccgacgt gcccgtgccc       900
     cagagcgcgc atctggagcg cttcgtggtg ccgcagacgg aggacatagt gaacgcggtg       960
     agggaggtgg ccgggtcggc ggtcaccgtt tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page