(data stored in ACNUC7421 zone)

EMBL: CP000386.PE345

CP000386.PE345       Location/Qualifiers
FT   CDS_pept        375803..376993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0350"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment catalytic domain of
FT                   components of various dehydrogenase complexes E3 binding;
FT                   KEGG: tfu:Tfu_3051 pyruvate dehydrogenase complex, E2
FT                   component, dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03326"
FT                   /db_xref="GOA:Q1AZ52"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ52"
FT                   /protein_id="ABG03326.1"
FT                   /translation="MHKLHLPRLGQTMERGTILRWARREGEPFEVGDILYEVESEKAVN
FT                   EIEAKLPGTLARITVEEGQECPVGTLLAVVADPGETLSEEEIEAAIAEEGGREAPAASG
FT                   GGTGVRAPSSARAQRRVRAMPKARALARELGVELAAVEGTGQGGAITVEDVRRAAGAAP
FT                   GEGPRVRERRPLGDVGRTMARVVTRSWHEVPQFVQMVQLDASALVGRRRELAGQIKRSH
FT                   GVDLSYTDLLLEAVAGAAGEEPLANSSLVDGEILLYEDVNVSVAVATGSGLLVPVVRWA
FT                   QALELGELAARLREVLERARSGRLSAEDTAGGTITLSNLGMYGIEGGTPLVTHPQAAVV
FT                   FAGAIVERPWAVSGRVEVRPTLTLSVGFDHRILDGVAAARFTTALRRRLESPNQEG"
     ttgcacaagc ttcaccttcc ccggctcggg cagaccatgg agcggggaac catactacgc        60
     tgggccaggc gcgaggggga gcccttcgag gtgggggaca tcctctacga ggtcgagtcg       120
     gagaaggccg tcaacgagat cgaagccaag ctacccggta cgctcgcccg catcacggtc       180
     gaggaggggc aggagtgccc ggtggggacg ctcctggcgg tcgtggccga cccgggcgag       240
     acgctctccg aggaagagat cgaggcggcc atagccgagg agggcgggag ggaggccccc       300
     gcggcctccg ggggcgggac cggggtccgg gcgccgtcct ccgcccgggc gcaaaggcgg       360
     gtccgcgcga tgcccaaggc ccgcgctctc gccagggagc tgggcgtgga gctagccgcg       420
     gtagaaggaa ccggccaggg aggagcgata accgtcgagg acgtccggcg ggccgccggg       480
     gctgcgccgg gcgaggggcc gagggtgagg gagaggcgtc cgctcggcga cgtcgggcgg       540
     accatggccc gggttgtgac ccgcagctgg cacgaggtgc cgcagttcgt gcagatggtg       600
     cagctcgacg caagcgcgct cgtggggcgc aggcgcgagc tggcagggca gataaagcgt       660
     tctcacggcg tggacctctc ctacaccgac ctgctcctcg aggccgtggc cggcgccgcg       720
     ggtgaggagc cgctcgccaa ctcctccctg gtggacgggg agatcctcct ctacgaggac       780
     gtcaacgtct ccgtggccgt tgcgaccggg tccgggctgc tcgtgcccgt ggtaaggtgg       840
     gcgcaggcct tggagctcgg agagctcgcc gccaggctac gcgaggttct cgagcgcgcg       900
     cgcagtggtc gtctctcggc tgaggatacc gcggggggca ccataacgct ctccaacctc       960
     ggcatgtacg ggatagaagg cggcacgccc ctggtcaccc acccgcaggc cgcggtggtt      1020
     ttcgccgggg ccatcgtcga gcgtccctgg gccgtctccg ggcgggtcga ggtccgcccg      1080
     accctcacgc tctctgtcgg gttcgaccac aggatcctcg acggcgtcgc ggccgcgcgc      1140
     ttcaccaccg cgctgagaag aaggctggag agcccaaacc aggagggcta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page