(data stored in ACNUC7421 zone)

EMBL: CP000386.PE351

CP000386.PE351       Location/Qualifiers
FT   CDS_pept        complement(382349..383050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03332"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ46"
FT                   /protein_id="ABG03332.1"
FT                   /translation="MNVRIRAITPIRVSEAELARRQARYESLSPPGVEVELANLPDRPG
FT                   VPHRLDSARDIRFSEELVIEEALRTDPARHDAVLPDCVLDPGLDRLERESPVPAFGILK
FT                   LSAGLLVSLGHRFAAFTRNRPIGEELRDRLEAYGFLPSFDRVEVLDLAFEAIADDEGWN
FT                   EALRESGQRFSGSSTTAVINGCSAVELRPAGNAVAVVDPTRLALSLLGLAAGEGLGPLG
FT                   RPGRRGGGLGR"
     gtgaacgtgc gtatcagagc cataaccccc atccgcgtga gcgaggcaga gctcgcgcgg        60
     cgccaggccc gctacgagtc cctcagcccc ccgggcgtag aggtcgagct ggcgaacctg       120
     ccggaccgcc ccggggtgcc ccacaggctc gactcggcgc gggacatccg gttttcggag       180
     gagctcgtga tcgaggaagc cctgagaacc gacccggcgc gccacgacgc cgtgctgccg       240
     gactgcgtgc tcgaccccgg cctcgaccgg ctcgaacgcg agtctcccgt accggccttc       300
     ggcatcctga agctctccgc cgggctgctg gtctcgctcg gccaccgctt cgccgccttc       360
     acccgcaacc gccccatcgg cgaggaactg cgggaccgcc tcgaagccta cggctttctc       420
     cccagcttcg accgcgtgga ggtcctcgac ctcgccttcg aggccatcgc cgacgacgag       480
     ggctggaacg aggccctccg cgagtccggg cagcgcttct ccggctcgag caccacggcc       540
     gtcatcaacg gctgctccgc cgtggagctc cgcccggccg gcaacgccgt cgccgtggtg       600
     gacccgacca ggctcgccct ctcgctcctg ggcctggccg ccggcgaggg cctgggtccg       660
     ctggggaggc ccgggagacg gggaggcggc cttggccgct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page