(data stored in ACNUC7421 zone)

EMBL: CP000386.PE355

CP000386.PE355       Location/Qualifiers
FT   CDS_pept        complement(386592..387323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0360"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ape:APE2524 putative branched-chain amino acid transport
FT                   system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03336"
FT                   /db_xref="GOA:Q1AZ42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ42"
FT                   /protein_id="ABG03336.1"
FT                   /translation="MTLLEVQDVSKSFAGLRALHSVSLQVERGSIVGLIGPNGAGKTTL
FT                   FNVIAGVMKPDAGRVLFDGTDVTGWPPYRIARLGIGRTFQLMKPFDTLSVLDNVTVATL
FT                   QRHRSRKEARRAATEVVERVGLGEWADRKASVLSTAGYKRLELAKALGLEPSLLLLDEV
FT                   LAGLVPAERARVVELLREIRAEGVTMLLVEHVMSAVMALSDHVYVLHHGEMLASGTPEE
FT                   VTKDPRVIEAYLGEEGHHAGA"
     gtgacgctgc tcgaggtaca ggacgtgagc aagtccttcg ccgggctcag ggcgctgcac        60
     agcgtctccc tgcaggtcga gagggggagc atcgtcggcc tgatcggacc gaacggcgcg       120
     ggcaagacca cgctcttcaa cgtaatcgcc ggcgtgatga agcccgatgc ggggcgcgtc       180
     ctcttcgacg gcaccgacgt gaccgggtgg cccccgtacc ggatcgcccg cctcggcatc       240
     gggcgtacct tccagctcat gaagcccttc gacaccctct ccgtcctgga caacgtcacc       300
     gtcgccaccc tgcagcgcca ccgcagccgc aaggaggccc gccgggcggc gaccgaggtc       360
     gtcgagcgcg tcgggctggg cgagtgggcg gacaggaagg cctccgtcct ctccaccgcg       420
     gggtacaagc gcctggagct cgccaaggcg ctcggcctcg agccctcgct cttgctgctg       480
     gacgaggtcc tcgccgggct cgtgcccgcc gagcgggccc gggtggtcga gctgctgcgg       540
     gagatacggg ccgaaggcgt gacgatgctc ctcgtggagc acgtcatgtc cgccgtcatg       600
     gcgctctcgg accacgtcta cgtcctccac cacggggaga tgctcgccag cggaacgccg       660
     gaggaggtaa cgaaggaccc ccgggtcata gaggcctacc tgggagaaga ggggcaccat       720
     gctggcgctt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page