(data stored in ACNUC7421 zone)

EMBL: CP000386.PE360

CP000386.PE360       Location/Qualifiers
FT   CDS_pept        391609..392799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0365"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: sco:SCO2032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03341"
FT                   /db_xref="GOA:Q1AZ37"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ37"
FT                   /protein_id="ABG03341.1"
FT                   /translation="MERHRALEGIKVIDAANLFAGPLAATILGDFGAEVIKVEHPRGDP
FT                   SRYHGYSKDGVGLWWKFLGRNKKCVTLNLSKPEGQEIFRRLAGDADVVIESFRPGTFER
FT                   WNLGYEELEKGNPGLILARVTGFGQFGPYKDRPGFGTLAESMSGFAYVTGQPDGPPTLP
FT                   PFGLADGIAALATAVAVLMALRARDVTGRGQVVDLAIIEPIFTILGPQPTVYDQLGIVQ
FT                   KRSGNRSVNNAPRNIYKTKDGHWVAVSTSAQNIAERVMRLVGRPEYVDEPWFQKGSERA
FT                   KHADELDEAVGGWISERTREEVMEAFEEAGAAVAPIYSIADIMEDPQYRALESIITVDD
FT                   PELGPIKMQNVLFRLSETPGEVRWSGPRLGEHNEEVYGELGLGRKDLEELAGKGVL"
     ttggagaggc acagagccct cgaagggatc aaggtcatcg acgctgcgaa cctgttcgcg        60
     ggtcccttgg cggccacgat cttgggggac ttcggggccg aggtcatcaa ggtggagcac       120
     ccccgcggcg acccctcccg ctaccacggc tactccaagg acggcgtggg gctgtggtgg       180
     aagtttctcg ggcgcaacaa gaagtgcgtc acgctcaacc tgagcaagcc ggaggggcag       240
     gagatcttca ggcggctcgc cggagacgcc gacgtcgtga tagagagctt ccggcccggc       300
     accttcgagc ggtggaacct cggctacgag gagctagaga aggggaaccc cggcctcatc       360
     ctcgcccgcg tcaccggctt cgggcagttc gggccgtaca aggaccgccc cggcttcggc       420
     actctggcgg agtccatgag cggcttcgcc tacgtcaccg ggcagcccga cggcccgccg       480
     accctgccgc cgttcgggct ggccgacggc atcgccgcgc tggcgacggc ggtggcggtc       540
     ctgatggccc tgagggcccg cgacgtcacg gggaggggtc aggtggtgga cctggcgatc       600
     atagagccca tcttcaccat cctaggaccg cagccgaccg tctacgacca gctcggcatc       660
     gtccagaagc gcagcggcaa tcgctccgtc aacaacgccc cgcgcaacat ctacaagacc       720
     aaagacggcc actgggtggc cgtctctacc agcgcccaga acatcgccga gcgggtcatg       780
     aggctcgtgg ggcgcccgga gtacgtcgac gagccctggt tccagaaggg ctccgagcgc       840
     gccaagcacg ccgacgagct ggacgaggcg gtgggaggct ggatctcgga gcgcaccaga       900
     gaagaggtca tggaggcctt cgaggaggcg ggcgccgccg tggccccgat ctacagcatc       960
     gcggacatca tggaggaccc gcagtacagg gccctcgaat ccatcatcac cgtggacgac      1020
     cccgagctcg gccccatcaa gatgcagaac gtgctcttca ggctctcgga gacgcccggc      1080
     gaggtaaggt ggtccggacc ccggctcggc gagcacaacg aggaggtcta cggagagctg      1140
     gggctcggca ggaaagacct ggaggagctc gccgggaagg gcgtcctgtg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page