(data stored in ACNUC7421 zone)

EMBL: CP000386.PE361

CP000386.PE361       Location/Qualifiers
FT   CDS_pept        392796..393656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0366"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bte:BTH_II2226
FT                   probable citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03342"
FT                   /db_xref="GOA:Q1AZ36"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ36"
FT                   /protein_id="ABG03342.1"
FT                   /translation="MTPTAAPPRSYLYVPGSDPRRIEKALSSEADAVVLDLEDAVAPDH
FT                   KEEARENVAGVLARANRKPVFVRVNAPGSALCGRDVEAVARPGLAGVRLPKTESAEEVR
FT                   RVAERLEELGCEAGVQCLIESALGLEMAFELARSHPRVTGLSLGEADLAADLGASGEEG
FT                   LLYARSRVVAASRAAGLQRPVQSVYTNVRDLDGLRRSTEAGKRLGFFGRSAIHPAQLPV
FT                   INEVFTPTEEEVAEARELLSRMEGAAASGSGAFVLEDGRFVDEAVVRAARFTLAVARGA
FT                   NGEER"
     gtgaccccga ccgcggcacc cccgcgcagc tacctctacg tccccgggag cgacccgcgc        60
     aggatcgaga aggcgctctc cagcgaggcg gacgccgtgg tcctcgacct cgaggacgcc       120
     gtcgcccccg accacaagga ggaggcccgg gagaacgtcg ccggggtgct cgcgcgcgcg       180
     aaccgcaagc ccgtcttcgt ccgggtgaac gccccgggca gcgcgctctg cgggcgcgac       240
     gtcgaggcgg tggcccgtcc cgggctcgcc ggggtacggc tgccgaagac ggagtccgcg       300
     gaggaggtgc gccgggtcgc ggagaggctg gaagagcttg gctgcgaggc gggcgtccag       360
     tgcctcatcg agtccgccct cgggctcgag atggccttcg agcttgcgcg ctcccacccg       420
     cgcgtcacgg gcctctccct cggcgaggcc gacctcgccg ccgacctcgg ggcgagcggc       480
     gaggaggggc tgctctacgc ccgctcgcgg gtcgtcgcgg cctccagggc ggccggcctg       540
     cagcgcccgg tgcagagcgt gtacaccaac gtgcgcgacc tcgacgggct gcggcgctcg       600
     accgaggcgg gcaagcggct cgggttcttc gggcgctcgg cgatccaccc ggcccagctt       660
     cccgtcatca acgaggtctt cacccccaca gaagaggagg tggccgaggc cagagagctg       720
     ctgagcagga tggagggcgc ggccgcgtcg ggcagcggcg ccttcgtgct ggaggacggg       780
     aggttcgtgg acgaggccgt cgtccgggcg gcgcgcttca cgctcgccgt cgcccgcggc       840
     gcgaacgggg aggagcgatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page