(data stored in ACNUC7421 zone)

EMBL: CP000386.PE369

CP000386.PE369       Location/Qualifiers
FT   CDS_pept        400962..402263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0374"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: bja:bll0889 putative
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03350"
FT                   /db_xref="GOA:Q1AZ28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ28"
FT                   /protein_id="ABG03350.1"
FT                   /translation="MGERSPLGRVITSSVVGNIIEQFDFALYGSMAALVFGPLFFPEFS
FT                   PLAGTLAALATFAVGFVARPLGSIFFGHFGDRIGRKSMLVLCLLIAGSATFLMGVLPTY
FT                   ATIGIWAPVLLVTLRFVQGFSFGGEYAGAVLMVAEYAPPERRGFFSGFVPAGSPVGLML
FT                   ANGTVLLVALMPREQFLAWGWRLPFLFSIVLVAIGLYIRLKIYETPAFRRVRETRTEAR
FT                   MPIIDVLRRSPGRVLLAGGISFGFAAIFYITIIFLLSYGTSQLGISGSVLLVGTIIGAV
FT                   FQIATILGFNALSDRIGRRPVIIGGALVSAALAFPFFWLLQSGAPALVWLAITAMMVSS
FT                   AAIYGPLAVLLAELFGTRLRYSGASLGYQLGATIGGGFSPLIATSILAWSGGGPWPVAL
FT                   YLVAVGLVAAACTYLLTETVRADMLEDVPAVGYE"
     atgggcgaac gctcgcctct ggggcgtgtg atcacctcga gcgtcgtcgg caacatcatc        60
     gagcagttcg acttcgccct ctacggttcg atggcggcgc tggtcttcgg gccgctgttc       120
     ttccccgagt tctcgccgct ggccgggacg ctcgcggccc tggcgacctt cgcggtgggg       180
     ttcgtggccc ggccgctcgg gagcatcttc ttcgggcact tcggggacag gatcgggcgc       240
     aagagcatgc tcgtcctgtg cctcctgatc gcgggctccg cgaccttcct gatgggggtg       300
     ctgccgacct acgcgaccat cggcatctgg gcgcccgtcc tgctggtgac gctgcgcttc       360
     gtgcagggct tctccttcgg gggggagtac gccggcgcgg tgctgatggt cgccgagtac       420
     gctcccccgg agaggagggg cttcttctcc gggttcgtgc cggcgggctc gcccgtgggc       480
     ctgatgctcg ccaacgggac cgtccttctg gtcgccctga tgccccggga gcagttcctc       540
     gcctggggct ggcgcttgcc gttcctcttc tccatagtcc tggtggccat cgggctctac       600
     atccggctga agatctacga gaccccggct ttcaggcgcg tcagggagac gaggaccgag       660
     gcgcgcatgc ccatcataga cgtgctgcgg cgcagcccgg gcagggtgct cctggccggg       720
     gggatcagct tcggcttcgc cgcgatcttc tacatcacca tcatcttcct gctgagctac       780
     ggcacctcgc agctggggat ctccgggagc gtgctcctgg tcggcacgat catcggggcc       840
     gttttccaga tagcgaccat cctggggttc aacgcgctct cggaccgcat cgggcgccgc       900
     ccggtgatca tcggcggcgc gctggtctcg gcggccctgg ccttcccctt cttctggctg       960
     ctgcagagcg gcgccccggc gctggtgtgg ctggccatca cggcgatgat ggtctcgagc      1020
     gcggccatct acggccccct ggcggtcctg ctggccgagc tcttcggcac ccgcctgcgc      1080
     tacagcggag cctctttagg ctaccagctc ggggctacca tcggcggcgg cttctcgccc      1140
     ctgatcgcaa cctccatcct ggcctggtcc gggggcggtc cctggccggt ggccctgtac      1200
     ctggtggcgg tgggcctggt ggcggccgcc tgcacctacc tgctgaccga gaccgtgcgg      1260
     gcggacatgc tggaggacgt gcccgcggtc ggctacgagt ag                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page