(data stored in ACNUC7421 zone)

EMBL: CP000386.PE37

CP000386.PE37        Location/Qualifiers
FT   CDS_pept        39047..39886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0037"
FT                   /product="metal-dependent enzyme-like protein"
FT                   /note="KEGG: sth:STH72 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03018"
FT                   /db_xref="GOA:Q1B010"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B010"
FT                   /protein_id="ABG03018.1"
FT                   /translation="MHRIRAPGEEALAAGASEERLTFGGMARWDGLDLFGPNYMSVAYR
FT                   RGGKVHVRIEPSRLRPPQSPAVRRLVRLPVVRSFFFWGRLVLQVAGSVWTLLFFAATLG
FT                   ALWLLVSLLEAGRDASGGLLGPLLGLLAEFPILPVLALFFAAMRLTPVGRYHGAEHKAV
FT                   AAYERYGEVTLEKARASSRIHPRCGTNILLYIILAALADPFIGWWGYSVLQFLLISEAW
FT                   FVFGQSRPSVAVGSFLQRYFTTTEPRRAELEVAVESLRRLLRAEEESAGEGAARMPA"
     atgcaccgta tacgagcgcc gggagaggaa gctttggcag ccggagcgag cgaggagcgc        60
     ctgaccttcg gggggatggc ccgctgggac gggctggacc tcttcggccc caactacatg       120
     agcgtcgcct accgcagggg cggcaaggtc cacgtccgga tagagccctc ccggctgcgc       180
     ccgccgcaga gcccggccgt ccgccggctg gtgcggctgc cggtggtccg ctcgttcttt       240
     ttctggggcc ggctcgtcct gcaggtggcg ggctcggtgt ggaccctgct cttcttcgcc       300
     gccacgctcg gggcgctgtg gcttctggtg agcctgctgg aggcgggccg ggacgcctcg       360
     ggaggccttc tcggtccgct cctcggcctt ctcgccgagt tccccatcct gcccgtgctc       420
     gcgctcttct tcgccgccat gcgcctcacc cccgtgggcc gctaccacgg cgcggagcac       480
     aaggccgtcg ccgcctacga gcgctacggc gaggtgaccc tggagaaggc ccgggcgagc       540
     agccggatcc acccgcgctg cgggacgaac atcctcctct acatcatcct cgccgccctc       600
     gccgacccgt ttatcgggtg gtggggctac tccgtcctgc agttcctcct gatctccgag       660
     gcctggttcg tcttcggcca gagccggccc tccgtcgcgg tgggcagctt tctgcagcgc       720
     tacttcacca ccaccgagcc gcgccgggcg gagctggagg tggcggtgga gtcgctgcgg       780
     cggctgctgc gggccgagga ggagagcgcc ggggagggcg ccgcgcggat gccggcctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page