(data stored in ACNUC7421 zone)

EMBL: CP000386.PE380

CP000386.PE380       Location/Qualifiers
FT   CDS_pept        413718..414488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03361"
FT                   /db_xref="GOA:Q1AZ17"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ17"
FT                   /protein_id="ABG03361.1"
FT                   /translation="MRESAALWPGSAVREVSLRSVDGLRLRAYWHPGGDRAAVLLHGKR
FT                   GSGRSEAVVATARVYAGAGFGVLVPDLRGRGGSEGRFLTAGYQEERDVRGALRWLAERG
FT                   FEARRVVLHGWSAGGAAALRAAPGAGVGAVVEDSAFAELPLLLGDLFPGPPRLLCGAAR
FT                   LVSRVLGTEFDPWALCPREDAARLYGEGVPLLIIHCRGDRVVPFRHAELLAAAHPAADF
FT                   WEVADGFHGGAYAHPGYRERLLGFVERALGPGGG"
     atgagggaga gtgccgccct ttggccgggg agcgcggtgc gggaggtttc cctgaggagc        60
     gtagacgggc tgcgcctgcg ggcctactgg caccccggcg gggaccgcgc cgccgtcctg       120
     ctgcacggca agcggggcag cgggcggagc gaggccgtgg tggcgacggc ccgcgtctac       180
     gccggggcgg gcttcggggt gctggtgccg gacctccggg ggcggggcgg ctccgagggg       240
     aggtttctca cggcgggcta ccaggaggag cgcgacgtgc ggggcgccct gcgctggctc       300
     gcggagcgcg gtttcgaggc gcggcgggtc gtgctccacg gctggtcggc gggcggggcg       360
     gcggcgctgc gggctgctcc gggggcgggc gtgggggcgg tggtggagga ctcggccttc       420
     gcggagctgc cgctgctgct cggggacctc ttccccggcc ctccccggct cctgtgcggg       480
     gcggcgcgcc tggtctccag ggtcctgggc acggagttcg acccctgggc gctgtgcccg       540
     agggaggacg ccgcgcggct ctacggggag ggggtgccgc tcctgatcat ccactgccgg       600
     ggcgaccggg tggtcccgtt ccgccacgcc gagctgctcg ccgccgccca cccggcggcg       660
     gacttctggg aggtcgcgga cgggttccac ggcggggcct acgcccaccc gggctaccgg       720
     gagcggctcc tcgggttcgt ggagcgggct ctgggcccgg gaggcggctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page