(data stored in ACNUC7421 zone)

EMBL: CP000386.PE381

CP000386.PE381       Location/Qualifiers
FT   CDS_pept        complement(415243..416556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0387"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gsu:GSU3264 membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03362"
FT                   /db_xref="GOA:Q1AZ16"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ16"
FT                   /protein_id="ABG03362.1"
FT                   /translation="MRPRPTAAPGRVLSWTLYDFASTVFSVSILSYFFPLWLADELGAG
FT                   ADLFNYITAASMVLVFLTAPLLGALADLGQRRKPYLAASTLLAVGCTAGLELSGSLAAA
FT                   VALFVAGNLGYQWAQIFYNALLPGVAPGRSTGRVSGYGGVAGYAGTIVALAALTPLVTH
FT                   PEAVRSALGPLGFWLETEGATNSNAFLPTAALYLIFGLPALLWVPDRAAREPRPAGLVR
FT                   GYREVLHTIRGLRGYAGMGAFMLSTVLYMDVSNTVVANMALYGREVFGMEQADIRNLLL
FT                   LSTVFAAAGAAGFGLVADLLGPKRTLMAVLGLWLAAIAAVAAATEAWMLLLAGPLVGVV
FT                   FGATGPVSRVLLIALSPPAKLGEFFGFYALAGRFSAATGPALTGLILTAFEPLGTGAYR
FT                   LAVLSLAAATVLAMAVLAHVPDRRPPEPAWNPAAEGGG"
     ttgaggccga ggcccacagc cgcacccggc cgggtcctct cctggacgct ctacgacttc        60
     gcgagcaccg tcttctcggt gagcatcctc agctacttct tccccctgtg gctcgccgac       120
     gagctggggg ccggggcgga cctcttcaac tacatcacag cggcctccat ggtcctcgtc       180
     ttcctcaccg ccccgctcct cggggcgctg gccgacctgg ggcagcgccg caagccctac       240
     ctggccgcct ccaccctgct ggcggtgggc tgcacggcgg ggctcgagct ctcggggagc       300
     ctggccgccg ccgtggcgct gttcgtggcg ggcaacctgg gctaccagtg ggcccagatc       360
     ttctacaacg ccctgttgcc cggggtggcg ccgggaagga gcacggggcg ggtgagcggc       420
     tacggcgggg tcgccgggta cgcgggcacc atcgtggcgc tggccgccct caccccgctc       480
     gtcacccacc cggaggcggt gaggtcggcg ctcggcccgc tggggttctg gctggagacg       540
     gagggcgcca ccaactccaa cgcctttctc ccgacggcgg cgctctacct tatcttcggc       600
     ctgccggcgc tcctgtgggt gcccgacagg gcggcgcggg agccccgccc ggcgggtctg       660
     gtgcgggggt accgcgaggt gctgcacacc atacgcgggc tccgcggcta cgcggggatg       720
     ggggcgttca tgctctccac ggtgctctac atggacgtct ccaacaccgt agtcgccaac       780
     atggcgctct acgggcggga ggtcttcggc atggagcagg ccgacatccg caacctgctc       840
     ctgctctcca ccgtgttcgc ggccgcgggg gcggcgggct tcgggctggt ggcggacctg       900
     ctgggcccca agcgcaccct gatggccgtg ctcgggctgt ggctcgcggc gatagcggcg       960
     gtcgcggccg ccaccgaggc ctggatgctc ctgctggccg ggccgctggt gggggtcgtc      1020
     ttcggggcca cgggcccggt gagccgggtg ctgctcatcg cgctctcccc gcccgcgaag      1080
     ctgggggagt tcttcgggtt ctacgccctg gccgggcggt tctccgccgc caccggcccg      1140
     gcgctcacgg gcctcatcct caccgccttc gaaccgctgg gcaccggcgc ctaccgcctg      1200
     gcggtgctct ccctcgccgc ggccaccgtc ctcgccatgg ccgtcctcgc ccacgtcccg      1260
     gaccggcgac caccggagcc ggcctggaat ccggcggcgg aggggggtgg ctag            1314
//

If you have problems or comments...

PBIL Back to PBIL home page