(data stored in ACNUC7421 zone)

EMBL: CP000386.PE382

CP000386.PE382       Location/Qualifiers
FT   CDS_pept        complement(416553..417437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0388"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV; KEGG:
FT                   deh:cbdb_A1004 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03363"
FT                   /db_xref="GOA:Q1AZ15"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ15"
FT                   /protein_id="ABG03363.1"
FT                   /translation="MAERRVAVVTESVSSLPRQLAGELEIEVVPVPFSYAGRDYLDGED
FT                   ITPEEFYGILRPDLPPASTSSPSPGAYLEVFRRLCGAGLEVLCVTATGKIATRMPESAR
FT                   MGRELAREEGVEGRIEVLDSGSAAMGEGFLALEAARMAWEGAGMEEILSRLEELSGRVS
FT                   LLVTLDTLQYLSKTARLRRLAALFAKALQIKPVILFERGEVRPLETPRTRRKAVERLLA
FT                   LAEERVSGEGPLHVAVQHAAAGEEAGELAEEVRERLGPRELLVAEFSPVMTSYAGPGLL
FT                   GLALYEEPPGAGP"
     atggctgaga gaagggtcgc cgtcgtaacc gagagcgtct cctcccttcc ccggcagctc        60
     gccggcgagc tggagataga ggtcgttccg gtgcccttca gctacgccgg gcgcgactac       120
     ctggacgggg aggacataac ccccgaggag ttctacggca tcctgcggcc ggacctcccc       180
     cccgcgagca cctcctcccc ctcccccggc gcctacctgg aggtcttcag gaggctgtgc       240
     ggggcggggc tggaggttct gtgcgtcacc gccaccggca agatcgccac ccggatgccg       300
     gagtcggccc ggatgggccg ggagctggcg cgcgaggagg gcgtggaggg caggatagag       360
     gtgctcgact ccggctcggc ggcgatggga gaggggttcc tggcgctgga ggccgcccgg       420
     atggcctggg agggcgcggg gatggaggag atcctctcgc gcctcgagga gctctcgggg       480
     cgcgtcagcc tgctggtcac cctggacacc ctgcagtacc tctccaagac ggcgcgtctc       540
     cggcggctcg cggccctgtt cgccaaggcg ctgcagataa agccggtcat cctcttcgag       600
     cgcggcgagg tgcgcccgct ggagaccccc aggacgcgca gaaaggcggt ggagcgcctg       660
     ctcgcgctgg ccgaagagcg cgtctcgggg gaggggcccc tgcacgtggc cgtgcagcac       720
     gccgcggccg gcgaggaggc cggggagctt gcggaggagg tccgggagcg cctcgggccc       780
     cgggagctgc tcgtcgccga gttctccccg gtgatgacca gctacgccgg ccccgggctg       840
     ctggggctgg ccctctacga ggagccgccg ggcgccggcc cttga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page