(data stored in ACNUC7421 zone)

EMBL: CP000386.PE385

CP000386.PE385       Location/Qualifiers
FT   CDS_pept        419125..419676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03366"
FT                   /db_xref="GOA:Q1AZ12"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ12"
FT                   /protein_id="ABG03366.1"
FT                   /translation="MGVMWGVVAVGEPVAGVLVFLLGGALRAARALRDLPGRRRAPGAL
FT                   PARYRLHGVELFPGIGVPLSRTTRYGATFAGVHRGEPAALLLGWVNYTPIFFKPSTECA
FT                   VVGGRWWLVAAEGGRPRVLRGRFGRGTVRWDGKGKLAAAEVGVRLGGRGGEGRLAAALN
FT                   HLPFPPRIGGALRLPGASGP"
     ttgggtgtga tgtggggggt ggtcgcggtg ggagagccgg tggccggggt gctggtgttc        60
     cttctcggcg gcgcgctcag ggcggcgagg gctctgaggg atctgccggg gaggcggcgc       120
     gcgccgggag cgctcccggc gcgttaccgt ctccacgggg tggagctctt ccccggcatc       180
     ggcgtccccc tcagccgcac cacccgctac ggggcgacct tcgcaggggt gcatcggggg       240
     gagcccgccg cgctgctcct ggggtgggtg aactacaccc ccatcttctt caagccctcc       300
     accgagtgcg ccgtcgtcgg ggggcgctgg tggctcgtgg ccgccgaggg ggggcggccg       360
     cgggtgctcc gggggcgctt cgggcgcgga accgtccggt gggacgggaa gggcaagctc       420
     gccgcggccg aggtgggggt gaggctcggg gggcggggag gggagggccg cctggcggcg       480
     gccctcaacc acctgccctt cccgccccgg ataggcggcg cgctgaggct gccgggggcc       540
     tcagggccct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page