(data stored in ACNUC7421 zone)

EMBL: CP000386.PE386

CP000386.PE386       Location/Qualifiers
FT   CDS_pept        complement(419665..420849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0392"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like Oxidoreductase-like; KEGG:
FT                   bms:BR0546 oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03367"
FT                   /db_xref="GOA:Q1AZ11"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ11"
FT                   /protein_id="ABG03367.1"
FT                   /translation="MQRLKMGMVGGGEGSFIGAVHRRAAALDGEIELVAGALSSTPEKA
FT                   LRSGRALGLPEGRNYASWEEMLEGELALPEEERIDFVSIVTPNHMHFPVARAFVRAGFD
FT                   VICDKPLVHTSEQALELVRAVEKAGTIFCVTYNYTGYPMVRQARHMVRSGMLGELRKVI
FT                   VEYSQGWLVRRLEDEDKQARWRTDPSLAGAAGAIGDIGSHAENLVATVTGLRISEICAD
FT                   LTTFVEGRRLDDDGNLLVRYEGGAKGVMISSQISTGEENNLSLRVYGTEGALQWRQEEP
FT                   NHLLFAPFGKPVQTLRRGNPYLCEEARAASRLPAGHPEAFIEAFANLYLEAAAAMRARR
FT                   GLSPERPPDFPTVYDGARGVHFIERVVESSRSEKKWLDARWEAPQPEGAGASGP"
     atgcagaggc tcaagatggg gatggtcggc gggggcgagg gctccttcat cggggcggtg        60
     caccggcggg cggccgcgct ggacggcgag atagagctcg tggccggggc gctctcctcc       120
     accccggaga aggccctccg ctccgggagg gcgctggggc tgccggaagg gaggaactac       180
     gccagctggg aggagatgct ggagggggag ctcgccctcc ccgaggagga gcgcatagac       240
     ttcgtcagca tcgtcacccc gaaccacatg cacttcccgg tcgcccgcgc cttcgtccgg       300
     gcggggttcg acgtgatctg cgacaagccg ctggtgcaca cctcggagca ggccctggag       360
     ctggtgcgcg ccgtcgagaa ggcgggcacg atcttctgcg tcacctacaa ctacaccggc       420
     tacccgatgg tccgccaggc ccggcacatg gtccgctccg gcatgctcgg cgagctgcgc       480
     aaggtcatcg tcgagtacag ccagggctgg ctcgtgcgcc ggctggagga cgaggacaag       540
     caggccaggt ggcgcaccga cccctccctg gccggggccg ccggggccat cggggacatc       600
     ggctcgcacg ccgagaacct cgtggccacc gtgaccgggc tccggatctc cgagatctgc       660
     gccgacctca ccaccttcgt cgagggccgc cgcctcgacg acgacggcaa cctcctcgtc       720
     cgctacgagg gcggggcgaa gggcgtcatg atctcctccc agatctccac gggagaggag       780
     aacaacctga gcctccgggt ctacggcacc gagggcgccc tgcagtggcg ccaggaggag       840
     ccgaaccacc tcctcttcgc gcccttcggg aagcccgtcc agaccctccg gcgcggcaac       900
     ccctacctct gcgaggaggc gcgggcggcg agccggctcc cggccgggca ccccgaggcg       960
     tttatcgagg cgttcgcgaa cctctacctg gaggccgcgg cggcgatgcg cgcccgccgc      1020
     ggcctctccc cggagaggcc cccggacttc cccaccgtct acgacggggc gcgcggggtg      1080
     cactttatcg agagggtggt ggagagcagc cgcagcgaga aaaagtggct cgacgcccgg      1140
     tgggaggccc cgcaacccga aggcgcgggg gcctcagggc cctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page