(data stored in ACNUC7421 zone)

EMBL: CP000386.PE388

CP000386.PE388       Location/Qualifiers
FT   CDS_pept        complement(421871..423115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0394"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like; KEGG: sme:SMb20013
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03369"
FT                   /db_xref="GOA:Q1AZ09"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ09"
FT                   /protein_id="ABG03369.1"
FT                   /translation="MQKKNAPPLRIGFVGSGFIARFHLEAFLGVRDARISGVFSPTPAH
FT                   REALAAEAGRLGLGPCAPFPSIESMLRSGEVDAVWLLGPNSTRLANMRAIHREVKAGRA
FT                   TLRGVACEKPLARNLAEAREMLRLAEDANLNHGYLENQLFSTAVRRGREIIWRRAAPIA
FT                   GRPYLARASEEHSGPHAPWFWRGEEQGGGVLSDMMCHSVEVARYLLTEPGRDRHSLRPL
FT                   SASATIATLKWGRREYARRLEETIGVDYSSSPVEDFARGTLALEDEAGNRLIIEATTSW
FT                   SYVGPGLRIQLELLGPEYAMEYSTLNSGLKVFLSRNVSGEAGEDLVEKQNAEQGLMPVL
FT                   EDEAASYGYTLEDRHMVGCFLRGERPEETFRDGVAVVELLMALYRSAETGRTIALPDPE
FT                   LEDYVPAVARGEYRG"
     atgcagaaga agaacgcgcc gccgctgcgc atagggttcg tcgggagcgg gtttatagca        60
     cgcttccacc tggaggcctt cctcggggtg agggacgcca ggatctccgg ggtcttcagc       120
     cccacccccg cccaccggga ggcgctcgcc gccgaggccg gccggctggg cctcggcccc       180
     tgcgccccct tcccctccat agagagcatg ctccgttccg gagaggtgga cgcggtctgg       240
     ctcctcggcc ccaacagcac ccgcctcgcc aacatgcgcg ccatccaccg cgaggtgaag       300
     gcggggcgcg ccaccctgcg cggcgtcgcc tgcgagaagc ccctcgcccg caacctcgcc       360
     gaggcccgcg agatgctccg cctggccgag gacgcgaacc tcaaccacgg ctacctggag       420
     aaccagctct tctccaccgc cgtccggcgg ggccgggaga tcatctggcg gcgggcggcc       480
     cccatagccg ggcggcccta cctggcccgg gcctccgagg agcactccgg cccccacgcc       540
     ccctggttct ggcgcggcga ggagcagggc gggggcgtcc tctcggacat gatgtgccac       600
     agcgtggagg tcgcccgcta cctgctcacc gagccgggca gggaccgcca cagcctccgc       660
     cccctctccg cgagcgccac catcgccact ctcaagtggg gccgccggga gtacgcccgc       720
     cgcctcgagg agacaatcgg cgtggactac tccagcagcc cggtggagga cttcgcccgc       780
     ggcaccctcg ccctggagga cgaggcgggc aaccggctca tcatcgaggc caccacctcc       840
     tggtcctacg tcggcccggg gctcaggata cagctcgagc tcctcggccc cgagtacgcc       900
     atggagtaca gcaccctgaa cagcgggctc aaggtcttcc tctcccgcaa cgtgagcggg       960
     gaggccggcg aggacctcgt cgagaagcag aacgccgagc agggcctgat gccggtgctg      1020
     gaggacgagg ccgcctccta cggctacacc ctggaggacc ggcacatggt cgggtgcttc      1080
     ctgcgcgggg agcggccgga ggagaccttc cgggacggtg tggcggtcgt ggagctgctc      1140
     atggcgctct accgctccgc cgagaccggg cgcaccatag ccctcccgga cccggagctc      1200
     gaggactacg tccccgcggt ggcccgcggg gagtaccgcg gttag                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page